SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2YL80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2YL80
Domain Number 1 Region: 81-142
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 1.7e-19
Family E6 C-terminal domain-like 0.0000202
Further Details:      
 
Domain Number 2 Region: 8-68
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00000000000000144
Family E6 C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2YL80
Sequence length 151
Comment (tr|A0A0G2YL80|A0A0G2YL80_HPV16) Protein E6 {ECO:0000256|HAMAP-Rule:MF_04006, ECO:0000256|RuleBase:RU363123, ECO:0000256|SAAS:SAAS01013181} OX=333760 OS=Human papillomavirus type 16. GN=E6 OC=Alphapapillomavirus. OH=9606
Sequence
MFQDPQERPTKLPDLCTELQTTIHDIILQCVYCKQQLLRREVYDFAFRDLCIVYRDGNPY
AVCDKCLKFYSKISEYRYYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLD
KKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
Download sequence
Identical sequences A0A0G2YL80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]