SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2YM71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2YM71
Domain Number 1 Region: 16-352
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 2.33e-129
Family Bacterial photosystem II reaction centre, L and M subunits 0.00000000000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2YM71
Sequence length 353
Comment (tr|A0A0G2YM71|A0A0G2YM71_9ROSI) Photosystem Q(A) protein {ECO:0000256|HAMAP-Rule:MF_01383} OX=1368268 OS=Geranium subcaulescens. GN=psbD OC=Pentapetalae; rosids; malvids; Geraniales; Geraniaceae; Geranium.
Sequence
MTIALGKFTKDENDLFDGMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY
THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA
FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF
RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ
AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV
SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Download sequence
Identical sequences A0A0G2YM71

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]