SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G3A8P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3A8P5
Domain Number 1 Region: 161-345
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-60
Family Methylesterase CheB, C-terminal domain 0.000013
Further Details:      
 
Domain Number 2 Region: 4-112
Classification Level Classification E-value
Superfamily CheY-like 1.57e-27
Family CheY-related 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G3A8P5
Sequence length 352
Comment (tr|A0A0G3A8P5|A0A0G3A8P5_9DELT) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=48 OS=Archangium gephyra. GN=AA314_09746 OC=Cystobacterineae; Archangiaceae; Archangium.
Sequence
MKPDKLRVLVAEDSPTARRLLVEILRADPAFEVVGEAKDGVEAVELTRRLRPHLVTMDIQ
MPNMDGLEATRRIMTEVPTPVVVVSTLVERDIQTSMAALRSGALAVLQKLVGPQAPDFET
EARRLRDTVKAMAEVKVIRHWPSRDEGPGPRVPVVPARRSKPALLAIAASTGGPAALHRI
FSELPADFPLPVLVVQHIALGFAKGLCTWLDSVCKLEVKVAEDGEALRPGVVYIAPDDRH
LGVRADGRVEVSNAAPVGGFRPSGTWLFRSVTRVFGSSLAAAVLTGMGQDGLEGLREVHA
AGGWVMAQDEATSVVYGMPGVAVAAGLAHEVLPLSDFSRRFRELAGGENGGA
Download sequence
Identical sequences A0A0G3A8P5
WP_047860966.1.54580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]