SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G3EA94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3EA94
Domain Number 1 Region: 196-458
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.42e-73
Family PFOR Pyr module 0.018
Further Details:      
 
Domain Number 2 Region: 1-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.32e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.003
Further Details:      
 
Domain Number 3 Region: 468-576
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.19e-24
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G3EA94
Sequence length 585
Comment (tr|A0A0G3EA94|A0A0G3EA94_BACTU) 2-oxoglutarate synthase subunit KorA {ECO:0000313|EMBL:ANS49636.1} KW=Complete proteome OX=1428 OS=Bacillus thuringiensis. GN=AXW78_17875 OC=Bacillus cereus group.
Sequence
MISQLSWKVGGQQGEGIESTGEIFCIALNRLGYYLYGYRHFSSRIKGGHTNNKIRVSTTE
VRAISDDLDILIAFDQETIDFNFHELRPGGIVVADAKFNPTIPDNTDVNLYVIPFTDIAS
ELGTSLMKNMVAVGASSAVLGLDETAYLDVVEEIFGRKGEQVVQKNMDAIKRGSQYMKEL
LGEKVNMMQLEKADGKKRMFMIGNDAIAFGAVAGGARFMSAYPITPASEIMEYLIKKLPK
VGGTVIQTEDEIAACTMAIGANYAGVRTLTASAGPGLSLMMEAIGLAGITETPLVIVDTQ
RGGPSTGLPTKQEQSDLMAMIYGTHGEIPKIVMAPSTVEEAFYDIVEAFNLSEEYQVPVI
FLTDLQLSLGKQTVEPLKLDKVEIRRGKLDLEAELPERENKAYFKRYEVTEDGVSPRVLP
GMKNGVHHVTGVEHDETGKPSESAINRKDQMDKRFRKMENLKFNTPVYKNVKHEEADVLL
VGFNSTRGAIEEAMTRLEQEGMKVNHAHVRLIHPFPTAEIDPLVKKAKRVVVVENNATGQ
LANIMKMNLGNGEKISSLLKYDGNPFLPKEIYNECKKGVVLNGNI
Download sequence
Identical sequences A0A023PA45 A0A0E8TJB9 A0A0F6FP64 A0A0F6J141 A0A0G3EA94 A0A0G8EKM8 A0A0K0SBX9 A0A0Q9GJI1 A0A0Q9HCP2 A0A135WW24 A0A160LD39 A0A193CW94 A0A1C9BX78 A0A1G1URE2 A0A1H5ZKS5 A0A1I4GDW7 A0A1M7GGI8 A0A1W2GJF1 A0A226QU95 A0A242XT92 A0A242ZFZ8 A0A243AAJ4 A0A243BWQ4 A0A243ER84 A0A243ERY8 A0A243FJI6 A0A243IVH6 A0A243M9S3 A0A2A2P3U2 A0A2A9HPD0 A0A2C9Z878 A0A2C9ZIS7 A0A2H3QMR5 B7ITM6 C2N4R7 C2P2B9 C2WRF2 C2XFD2 C3H4T6 G9Q3B1 J7VXX9 J8G651 J8H154 J8QFY3 J9BXL9 M1QQE3 Q3EKZ1 R8DZK5 R8FFH7 R8G197 R8GBE9 R8K3G2 R8LCW0 R8PKS2 S3INU4 V5MGF8 W8Y747
gi|452200156|ref|YP_007480237.1| WP_000625417.1.101720 WP_000625417.1.101838 WP_000625417.1.10745 WP_000625417.1.10845 WP_000625417.1.11442 WP_000625417.1.11521 WP_000625417.1.12553 WP_000625417.1.13975 WP_000625417.1.17374 WP_000625417.1.19516 WP_000625417.1.2206 WP_000625417.1.22152 WP_000625417.1.2251 WP_000625417.1.23245 WP_000625417.1.23360 WP_000625417.1.24795 WP_000625417.1.26459 WP_000625417.1.26483 WP_000625417.1.26872 WP_000625417.1.26965 WP_000625417.1.27106 WP_000625417.1.27931 WP_000625417.1.29836 WP_000625417.1.29993 WP_000625417.1.3180 WP_000625417.1.3249 WP_000625417.1.33790 WP_000625417.1.34061 WP_000625417.1.34175 WP_000625417.1.34587 WP_000625417.1.3546 WP_000625417.1.35694 WP_000625417.1.35769 WP_000625417.1.36279 WP_000625417.1.37239 WP_000625417.1.38325 WP_000625417.1.3925 WP_000625417.1.40034 WP_000625417.1.40430 WP_000625417.1.40818 WP_000625417.1.41090 WP_000625417.1.41729 WP_000625417.1.4185 WP_000625417.1.42218 WP_000625417.1.42485 WP_000625417.1.43434 WP_000625417.1.43442 WP_000625417.1.44348 WP_000625417.1.44428 WP_000625417.1.4447 WP_000625417.1.47975 WP_000625417.1.48759 WP_000625417.1.49702 WP_000625417.1.50042 WP_000625417.1.50694 WP_000625417.1.51047 WP_000625417.1.52284 WP_000625417.1.54142 WP_000625417.1.54547 WP_000625417.1.54777 WP_000625417.1.55077 WP_000625417.1.5543 WP_000625417.1.57561 WP_000625417.1.57732 WP_000625417.1.58586 WP_000625417.1.5895 WP_000625417.1.60255 WP_000625417.1.60526 WP_000625417.1.61243 WP_000625417.1.61799 WP_000625417.1.61820 WP_000625417.1.62277 WP_000625417.1.62770 WP_000625417.1.63743 WP_000625417.1.63789 WP_000625417.1.64421 WP_000625417.1.6475 WP_000625417.1.64764 WP_000625417.1.66999 WP_000625417.1.674 WP_000625417.1.68007 WP_000625417.1.6816 WP_000625417.1.69347 WP_000625417.1.70108 WP_000625417.1.71242 WP_000625417.1.71652 WP_000625417.1.72484 WP_000625417.1.72752 WP_000625417.1.74302 WP_000625417.1.74372 WP_000625417.1.74857 WP_000625417.1.74863 WP_000625417.1.7534 WP_000625417.1.7544 WP_000625417.1.75866 WP_000625417.1.75891 WP_000625417.1.75942 WP_000625417.1.76883 WP_000625417.1.77386 WP_000625417.1.77402 WP_000625417.1.77567 WP_000625417.1.79549 WP_000625417.1.80622 WP_000625417.1.81000 WP_000625417.1.81570 WP_000625417.1.84541 WP_000625417.1.84775 WP_000625417.1.85348 WP_000625417.1.85667 WP_000625417.1.8577 WP_000625417.1.86374 WP_000625417.1.86763 WP_000625417.1.869 WP_000625417.1.87013 WP_000625417.1.87705 WP_000625417.1.87725 WP_000625417.1.87777 WP_000625417.1.87873 WP_000625417.1.87947 WP_000625417.1.88269 WP_000625417.1.90254 WP_000625417.1.90452 WP_000625417.1.90466 WP_000625417.1.91020 WP_000625417.1.91367 WP_000625417.1.92555 WP_000625417.1.93838 WP_000625417.1.94308 WP_000625417.1.94914 WP_000625417.1.9533 WP_000625417.1.9623 WP_000625417.1.96272 WP_000625417.1.9700 WP_000625417.1.9703 WP_000625417.1.97082 WP_000625417.1.97327 WP_000625417.1.97561 WP_000625417.1.97816 WP_000625417.1.97830 WP_000625417.1.98053 WP_000625417.1.9860 WP_000625417.1.99636 405531.BCG9842_B1426 gi|434376832|ref|YP_006611476.1| gi|558682331|ref|YP_008820460.1| gi|384187778|ref|YP_005573674.1| gi|410676095|ref|YP_006928466.1| gi|218898874|ref|YP_002447285.1| gi|449090718|ref|YP_007423159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]