SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G3EWK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3EWK5
Domain Number 1 Region: 740-987
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-35
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 
Domain Number 2 Region: 29-252
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.3e-20
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.07
Further Details:      
 
Domain Number 3 Region: 456-642
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.28e-17
Family Pyruvate oxidase and decarboxylase PP module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G3EWK5
Sequence length 1183
Comment (tr|A0A0G3EWK5|A0A0G3EWK5_9BURK) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:AKJ69792.1} KW=Complete proteome; Reference proteome OX=445709 OS=Pandoraea thiooxydans. GN=ABW99_17860 OC=Burkholderiaceae; Pandoraea.
Sequence
MNAPVNASLLAALDSVTLDDKYTLEQGRAYMSGIQALVRLPMLQQQRDASAGLNTAGFIS
GYRGSPLGGLDLSLWKAKQHLAGRNIVFQPGVNEDLAATAVWGSQQTNLYPAKYDGVFAM
WYGKGPGVDRSGDVFKHGNSAGSSRHGGVLVLAGDDHAAKSSTLAHQSEHVFKACGLPVL
YPSNVQEYLDYGLHGWAMSRYSGLWVAMKCVTDVVESSASVMIDPHHVRIALPEDFVMPP
DGLNLRWPDPPLVQEARLLDYKWYAGLAYVRANKLDRVTIDSPHARFGIMTAGKAYLDVC
QALSDLGLDEQTCSRIGIRLYKVGCVWPLEAQGARAFATGLQEILVVEEKRQILEYAIKE
ELYNWRDDVRPRVFGKFDEKDGAGGEWSVPMGNWLLPAHYELSPAVIAKAIATRLEKFEL
PSDVRARIAARIALIEAKEKALAKPRVAVERKPWFCSGCPHNTSTNVPEGSRAVAGIGCH
YMTVWMDRRTETFTQMGGEGASWIGQAPFSQDRHIFANLGDGTYFHSGLLAIRAAISSKV
NITYKILYNDAVAMTGGQPVDGVLTVPQITQQLAAEGAAKIVVVTDEPEKYQGVALAAGT
PVHHRDELDAVQRQLREVPGTTILIYDQTCATEKRRRRKRGTYPDPARRAFINDAVCEGC
GDCSVQSNCLSVEPLDTEFGTKRQINQSSCNKDFSCLKGFCPSFVTVEGAQPRKPKAAQA
SLDTLPTLPEPVLPPIRRPFGILVTGVGGTGIVTIGNLLGMAAHLEGKGVTTLDVTGLAQ
KGGAVMSHVQIANHPDDIHATRIAMGEAQVVIGCDAIVTASDDTLSRMQHGITRVVVNSA
HTPTAELIKNPDWQFPGSSTEQDIRNAAGDACDFVDAHQLALRLLGDAIYTNPFVLGYAW
QKGWIPLSHAALVRAIELNGVAIEKNRQAFEWGRRAAHDLASVQRLAQQDAAPNGANVIA
LHTPKALDTLIAQRCESLIAYQNAAYAQRYRSLVEKVRAAEQAASANPTQTPLTEAVARG
LYKLMAYKDEYEVARLYTDPAFMAKIQAQFEGNYQLKFHLAPPLFAKRDAHGNLLKKQYG
PWMMSAFKLLAKLKGLRGGPLDPFGKTEERRTERALIGEYETLVAELLSGLSERNLPLAV
QLASLPEEIRGFGHVKARNLAQVRAKWTRLLTQYRNPAQQQVA
Download sequence
Identical sequences A0A0G3EWK5
WP_047215701.1.29475 WP_047215701.1.88405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]