SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3QLC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0G3QLC7
Domain Number - Region: 29-88
Classification Level Classification E-value
Superfamily NosL/MerB-like 0.00392
Family MerB-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G3QLC7
Sequence length 105
Comment (tr|A0A0G3QLC7|A0A0G3QLC7_9ENTR) Uncharacterized protein {ECO:0000313|EMBL:KLV73045.1} KW=Complete proteome OX=1686382 OS=Citrobacter sp. MGH109. GN=SK37_04845 OC=Enterobacteriaceae; Citrobacter; Citrobacter freundii complex.
Sequence
MTDENQIKVLFCILRRRFVDYVPEFENCVEEREVINETPKGYRMSVSYGTSVYLHADYEF
FESRQAAYQWCARRVTASIEKMKQKMQAAEATKIKLIEASGNCGE
Download sequence
Identical sequences A0A064DX96 A0A0F0XMP6 A0A0G3QLC7 A0A0J0HQU8 A0A0P8U0C8 A0A1R0FRI8 A0A1S2A4A1 A0A1S2B6X5 A0A1V0LN56 A0A1X0X704 A0A2A5MYX9 A0A2H9ENS1 A0A2I8XPL2 A0A2J5K0P7 J6I8Q1 S1EZI9
WP_007372316.1.100506 WP_007372316.1.100526 WP_007372316.1.10913 WP_007372316.1.14465 WP_007372316.1.17119 WP_007372316.1.28995 WP_007372316.1.29681 WP_007372316.1.30029 WP_007372316.1.30830 WP_007372316.1.31671 WP_007372316.1.36988 WP_007372316.1.37697 WP_007372316.1.39797 WP_007372316.1.39904 WP_007372316.1.40153 WP_007372316.1.47139 WP_007372316.1.49375 WP_007372316.1.51555 WP_007372316.1.55514 WP_007372316.1.58767 WP_007372316.1.59216 WP_007372316.1.60926 WP_007372316.1.62651 WP_007372316.1.6287 WP_007372316.1.64017 WP_007372316.1.64248 WP_007372316.1.66241 WP_007372316.1.66915 WP_007372316.1.67087 WP_007372316.1.69799 WP_007372316.1.69838 WP_007372316.1.70804 WP_007372316.1.71148 WP_007372316.1.72655 WP_007372316.1.74830 WP_007372316.1.7722 WP_007372316.1.82903 WP_007372316.1.83562 WP_007372316.1.84607 WP_007372316.1.92621 WP_007372316.1.93213 WP_007372316.1.98537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]