SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G3WNU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3WNU5
Domain Number 1 Region: 731-970
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.02
Further Details:      
 
Domain Number 2 Region: 27-222
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.65e-16
Family Pyruvate oxidase and decarboxylase Pyr module 0.085
Further Details:      
 
Domain Number 3 Region: 441-628
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000235
Family Pyruvate oxidase and decarboxylase PP module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G3WNU5
Sequence length 1190
Comment (tr|A0A0G3WNU5|A0A0G3WNU5_BURPY) Pyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:AKL99565.1} KW=Complete proteome OX=60550 OS=Burkholderia pyrrocinia (Pseudomonas pyrrocinia). GN=ABD05_04760 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MTARLPIDGTPALSDYRLTDNLTATRGRIFLTGTQALVRLMLMQRTVDTELGLNTAGFVS
GYRGSPLGMVDQQLWKAKKLLDGSGVRFLPAINEELGGTAVLGTQRVEADPERTVEGVYA
MWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSSSMPHQSDFAMIAWHMPV
VNPANIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTVDLDALQTQWPAPAGFTPP
AGGLHNRWPDLPSLTIEARLAAKLDAVRHFARTNSIDKWIAPSAQANVGIVTCGKAHLDL
MEALRRLDLTVADLDAAGVRIYKVGLSYPLEMTRIETFVDGLAEVLVIEEKGPVIEQQIK
DYLYNRAEGARPRVLGKHDAAGACLLSELGELRPSRILPVFAEWLARHKPALDRRERVVD
LVAPQILSNEADAVKRTPYFCSGCPHNTSTKVPEGSIAQAGIGCHFMASWMERDTTGLIQ
MGGEGVDWAAHAMFTNTKHVFQNLGDGTYFHSGILAIRQAVAAKTNITYKILYNDAVAMT
GGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKYDGHHGLFPKGTTFHHRSELDAVQR
ELRETPGVTVLIYDQTCAAEKRRRRKKGEFPDPDKRLFINDAVCEGCGDCGVQSNCLSVE
PLETPLGRKRRIDQSSCNKDYSCVNGFCPSFVTVEGAALKKAAGAAFDEAALAVRVDALP
VPATHLDAAPFDMLVTGVGGTGVVTVGALISMAAHLEGKSASVLDFMGFAQKGGSVLSFV
RIAANDRWLNQVRIDTQQADVLLACDMVVGASAEALQTVRHERSRIVVNTHRIPNASFVQ
NPDANLHADALLEKMRHAAGDGYLSSCDAQALAAKFLGDSIGANILMLGYAWQLGLVPVS
LAAMMRAIELNNVAVPMNKLAFSIGRMAAGDAAGLDALWNARHAVATHAAPETLAELIAD
REARLDAYGGARYVERYRALVNAAAAKGDDALTRAVATTFYRLLAVKDEYEVARLFTDDA
FRTALEAQFEGVPGHAYRVKFNLAPPTVAKAGRDGSVPKKRVFGQWMWPVFGMLARVRSL
RGTWLDPFGRTVERRMERALADDYETTLARALAATTAGNAAQVTQLADLHARVRGFGHVK
VRNLAGVKRAERELALQLGIDAATSAAVQHALDEMKGAGMLKGIPVVVAK
Download sequence
Identical sequences A0A0G3WNU5
WP_047899172.1.84098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]