SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G4DC80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0G4DC80
Domain Number - Region: 65-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00126
Family F93-like 0.068
Further Details:      
 
Domain Number - Region: 19-70
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0238
Family Capz alpha-1 subunit 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4DC80
Sequence length 114
Comment (tr|A0A0G4DC80|A0A0G4DC80_BACTO) Tubulin/FtsZ family, GTPase domain protein {ECO:0000313|EMBL:BAR87774.1} KW=Complete proteome OX=1442 OS=Bacillus thuringiensis subsp. tolworthi. GN=KNN_07041 OC=Bacillus cereus group.
Sequence
MSNISMNSNEIIDVLCENLNDGIWALRVLYAEGAMHKEKLWDCINQYHKEYQIENEKDYE
GKKILPSRYSLDIMTARLEGAGLISFKPFGRVRVYEVTDLGNVLIKELEKRKKS
Download sequence
Identical sequences A0A0G4DC80 A0A2C0JTN4 J8M0M5
WP_000065647.1.19516 WP_000065647.1.2206 WP_000065647.1.29993 WP_000065647.1.32784 WP_000065647.1.5543 WP_000065647.1.81000 WP_000065647.1.86374 WP_000065647.1.87947 WP_000065647.1.93683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]