SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4JPM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4JPM8
Domain Number 1 Region: 7-41
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000327
Family Ribosomal protein L36 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G4JPM8
Sequence length 47
Comment (tr|A0A0G4JPM8|A0A0G4JPM8_9GAMM) 50S ribosomal protein L36 {ECO:0000256|HAMAP-Rule:MF_00251, ECO:0000256|RuleBase:RU000571} KW=Complete proteome; Reference proteome OX=1109412 OS=Brenneria goodwinii. GN=BN1221_00288 OC=Pectobacteriaceae; Brenneria.
Sequence
MQVLSSLHSAKKRHKDCIVVRRRGRIYVICKTNPRFKAVQGRKKKKS
Download sequence
Identical sequences A0A0G4JPM8
WP_072065916.1.56796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]