SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G4K3D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4K3D7
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-26
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4K3D7
Sequence length 214
Comment (tr|A0A0G4K3D7|A0A0G4K3D7_9GAMM) Pyruvate:ferredoxin oxidoreductase, gamma subunit {ECO:0000313|EMBL:CPR21631.1} KW=Complete proteome; Reference proteome OX=1109412 OS=Brenneria goodwinii. GN=BN1221_04994c OC=Pectobacteriaceae; Brenneria.
Sequence
MLDILWLGRGGQGAFTAARLLGLGAVRFADLEAMAFPSFGPERRGAPVYAYTRLSRSPIR
DRSPVRQALVAVVMDDALLPQLRADQLSAGALILIDGKHEQRFQQRSYGLEWRVPACQLA
EHHLGSRHTNTVLLGVLNGLLSLLAPAALEHAIISEFAPQWRPPAPLPERVRRNLAAFDA
AGRLGRTEKDLAGPLAAWLAVHRQAVDLQEAAHA
Download sequence
Identical sequences A0A0G4K3D7
WP_053085562.1.56796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]