SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4N5R5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4N5R5
Domain Number 1 Region: 223-298
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.4e-31
Family Skp1 dimerisation domain-like 0.0000298
Further Details:      
 
Domain Number 2 Region: 140-207
Classification Level Classification E-value
Superfamily POZ domain 3.3e-19
Family BTB/POZ domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G4N5R5
Sequence length 301
Comment (tr|A0A0G4N5R5|A0A0G4N5R5_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:CRK41966.1} KW=Complete proteome; Reference proteome OX=100787 OS=Verticillium longisporum. GN=BN1708_015842 OC=Plectosphaerellaceae; Verticillium.
Sequence
MTDFLCESCCVGSIAGVRTKVKRQTKPPSLLSPSTPSTCLITTYLPWYISAFAPIFRQHC
YFSNRQPTPPTNPSAFSPPFALHYQSSLHQPTSHSTTARKTTTADDIQLKHHLPRLLDAT
SISPLANPSDIKMADSSVPRVWVQSNDNATIAIDRPVAERSMLIRNLIEDIGDEGITADT
PIPIPNVNEAVLRKVIEWCEHHRNDPPQTQDDDNDARKKTTEIEEWDQKFMQVDQEMLFE
IILASNYLDIKPLLDVGCKTVANMIKGKSPEEIRKTFNITNDFTPEEEEQIRRENEWAED
R
Download sequence
Identical sequences A0A0G4N5R5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]