SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G4P6U6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4P6U6
Domain Number 1 Region: 335-520
Classification Level Classification E-value
Superfamily MIR domain 3.14e-57
Family MIR domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4P6U6
Sequence length 744
Comment (tr|A0A0G4P6U6|A0A0G4P6U6_PENCA) Glycosyl transferase, family 39 {ECO:0000313|EMBL:CRL22027.1} KW=Complete proteome; Reference proteome OX=1429867 OS=Penicillium camemberti FM 013. GN=PCAMFM013_S007g000008 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MAGIDTAVTTGAKPESDLRRRNIPGTSKHHVDSNRINDEDAKKARTQSPSFLHVLASWEP
IIAPIILTALALFTRLYQIGRSNIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLS
GYLAGYNGSFEFKSGEKYPEDVNYTFMRAFNAAFGIVCIPLAYYTARELNFRRATVWLIS
LMVLCENSYATISRFILLDSMLLCFTFTTTMCWARFHRLQRDSFSLEWYAWLCLTGLSIG
CVCSVKWVGFFCTALVGLYTIDDLWNKFGDLKMPRAVLAKHLVARVVGLIVIPILVYMFS
FYLHFLVLANSGPGDAQMSSLFQANLQGTEVGRDSPLELAIGSRITLKNMGYGGGLLHSH
VQTFPEGSMQQQVTCYHHKDANNDWFIYPNRQEPDYDATADLRFVGDGDVIRLIHGQTGR
NLHSHAIPAPITKSHHEVSSYGNITIGDDKDHWKVEVVDDVASRDRSRIRTLTTAFRLRH
PVLGCYLRAGNVNLPQWGFKQIETTCTKENKPGDVYTHWNVESHTNDRLPPGDPGSYKSP
FLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNVGLRMCSWDDSVVKYYLLGN
PLVYWGSTAALGGFGLLFLWYLLRWQRGYNDLSNEEISHIHYSGLYPVIGWVLHYLPFII
MARVTYVHHYYPALYYAILNFGFCIDWVTRKMNPRLSAVVYALLYVIIVGLFIHFRAIVF
GMEGSNQQWTHLRWLPGWKLANVN
Download sequence
Identical sequences A0A0G4P6U6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]