SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G4PRW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4PRW5
Domain Number 1 Region: 3-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.01e-84
Family Capz alpha-1 subunit 0.0000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G4PRW5
Sequence length 274
Comment (tr|A0A0G4PRW5|A0A0G4PRW5_PENCA) F-actin capping protein, alpha subunit, actin binding {ECO:0000313|EMBL:CRL29194.1} KW=Complete proteome; Reference proteome OX=1429867 OS=Penicillium camemberti FM 013. GN=PCAMFM013_S033g000114 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MASTIELASAFIEGAPPGELADVVADVQALTSEGEDIVPSLLSAFKRYNETQLATVKLPG
SSQEVIISGFNELEDNRYFDPESQTSFEVDHTTQTASAAQSYALESEHADLIKSLLKSFG
LHAREHYPNCSYGVYPIENDSAVAIVLVANRYSPNNFWNGRFRAIYQLPVSSSSSTLTGN
IHVDVHYYEDGNVALNTTKPINISVPSVTAESIVSRIAAAERDYQEALNRAFVQTSEGVF
KGLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR
Download sequence
Identical sequences A0A0G4PRW5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]