SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G4Q4C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4Q4C9
Domain Number 1 Region: 157-341
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.22e-75
Family Methylesterase CheB, C-terminal domain 0.0000000844
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.71e-27
Family CheY-related 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4Q4C9
Sequence length 350
Comment (tr|A0A0G4Q4C9|A0A0G4Q4C9_PROVU) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=585 OS=Proteus vulgaris. GN=BN1805_00716 OC=Morganellaceae; Proteus.
Sequence
MNKITVLCVDDSALMRQIMREIINSHSDMEVVDCAPDPIVARDLIKKYNPQVLTLDVEMP
RMDGIDFLEKLMRLRPMPVVMVSSLTAKGSEVTLKALELGAVDFVTKPQLGLREGMLAYS
ELIAEKIRAAALARISRREVHVVPSKSLSFTPMISSEKLIAVGASTGGTEAIRNFLEPLP
VTSPAVLITQHMPAGFTHSFAERLNRLCQISVKEAEDGERVLPGHAYVAPGDYHMELRRN
GANYQIHINKEPAVNRHRPSVDVLFRSVAKYAGRNAIGVILTGMGSDGAAGLLEMRQAGS
YTFAQDEASCVVFGMPRAAVEIGAVDEVKSISSMSKAVLMKISSTQSLRI
Download sequence
Identical sequences A0A0G4Q4C9
WP_072068534.1.56398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]