SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G9FA26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0G9FA26
Domain Number - Region: 104-152
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000654
Family GCC-box binding domain 0.023
Further Details:      
 
Domain Number - Region: 47-97,134-156
Classification Level Classification E-value
Superfamily MIR domain 0.0497
Family MIR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G9FA26
Sequence length 157
Comment (tr|A0A0G9FA26|A0A0G9FA26_LACPN) Alcohol dehydrogenase {ECO:0000313|EMBL:ANJ13990.1} KW=Complete proteome OX=1590 OS=Lactobacillus plantarum. GN=A8704_08370 OC=Lactobacillus.
Sequence
MGAAIDITGQHFGRLIAVHRAGRAKNGNALWFCQCQCGRTCVVDSYVLRHGKTRSCGCLA
VEQSRQNIFNNPQAVSHMGDPRNLKIRDHHTDVSSIKKSKRNTSGVVGVSYDKQSGSWVA
HFYYKGTYILNKHFAHFEDAVRARHAMEQQYLTSSDN
Download sequence
Identical sequences A0A0G9FA26 A0A2J6U2P7 A0A2K3C5C0 D7VAA0 F9UM73 M4KFL8 R9X1V4
gi|254555885|ref|YP_003062302.1| gi|308179863|ref|YP_003923991.1| gi|448820432|ref|YP_007413594.1| gi|501145983|ref|YP_007986321.1| gi|513840551|ref|YP_008120523.1| WP_003641111.1.100103 WP_003641111.1.100207 WP_003641111.1.100379 WP_003641111.1.100429 WP_003641111.1.100643 WP_003641111.1.101934 WP_003641111.1.102085 WP_003641111.1.1220 WP_003641111.1.12236 WP_003641111.1.12283 WP_003641111.1.1364 WP_003641111.1.13966 WP_003641111.1.14222 WP_003641111.1.15471 WP_003641111.1.15989 WP_003641111.1.16071 WP_003641111.1.17136 WP_003641111.1.17377 WP_003641111.1.182 WP_003641111.1.19859 WP_003641111.1.20190 WP_003641111.1.2169 WP_003641111.1.21914 WP_003641111.1.22404 WP_003641111.1.22467 WP_003641111.1.25460 WP_003641111.1.25870 WP_003641111.1.27617 WP_003641111.1.28597 WP_003641111.1.28802 WP_003641111.1.29036 WP_003641111.1.29793 WP_003641111.1.30329 WP_003641111.1.31165 WP_003641111.1.3126 WP_003641111.1.33461 WP_003641111.1.33465 WP_003641111.1.34542 WP_003641111.1.34594 WP_003641111.1.34840 WP_003641111.1.35369 WP_003641111.1.36601 WP_003641111.1.37110 WP_003641111.1.37210 WP_003641111.1.37234 WP_003641111.1.37302 WP_003641111.1.37367 WP_003641111.1.37888 WP_003641111.1.37993 WP_003641111.1.39741 WP_003641111.1.4007 WP_003641111.1.40915 WP_003641111.1.40917 WP_003641111.1.42053 WP_003641111.1.42956 WP_003641111.1.44182 WP_003641111.1.44305 WP_003641111.1.45255 WP_003641111.1.47368 WP_003641111.1.48352 WP_003641111.1.48891 WP_003641111.1.49499 WP_003641111.1.49875 WP_003641111.1.50091 WP_003641111.1.50648 WP_003641111.1.51711 WP_003641111.1.53564 WP_003641111.1.54321 WP_003641111.1.54513 WP_003641111.1.56089 WP_003641111.1.56224 WP_003641111.1.56240 WP_003641111.1.56426 WP_003641111.1.56520 WP_003641111.1.57 WP_003641111.1.59418 WP_003641111.1.59824 WP_003641111.1.60366 WP_003641111.1.60571 WP_003641111.1.62691 WP_003641111.1.6273 WP_003641111.1.64570 WP_003641111.1.65354 WP_003641111.1.65980 WP_003641111.1.66154 WP_003641111.1.6617 WP_003641111.1.66243 WP_003641111.1.68320 WP_003641111.1.6836 WP_003641111.1.68947 WP_003641111.1.69461 WP_003641111.1.69847 WP_003641111.1.69852 WP_003641111.1.69983 WP_003641111.1.71366 WP_003641111.1.71807 WP_003641111.1.731 WP_003641111.1.73311 WP_003641111.1.73499 WP_003641111.1.74718 WP_003641111.1.74868 WP_003641111.1.76397 WP_003641111.1.76549 WP_003641111.1.76699 WP_003641111.1.76771 WP_003641111.1.7682 WP_003641111.1.76822 WP_003641111.1.77336 WP_003641111.1.77712 WP_003641111.1.77972 WP_003641111.1.78144 WP_003641111.1.8010 WP_003641111.1.80520 WP_003641111.1.80904 WP_003641111.1.81615 WP_003641111.1.82268 WP_003641111.1.82388 WP_003641111.1.82602 WP_003641111.1.82735 WP_003641111.1.83366 WP_003641111.1.83620 WP_003641111.1.83647 WP_003641111.1.83777 WP_003641111.1.84028 WP_003641111.1.84419 WP_003641111.1.85206 WP_003641111.1.85836 WP_003641111.1.86479 WP_003641111.1.88099 WP_003641111.1.89420 WP_003641111.1.89637 WP_003641111.1.90117 WP_003641111.1.90208 WP_003641111.1.90300 WP_003641111.1.90426 WP_003641111.1.91137 WP_003641111.1.91351 WP_003641111.1.9149 WP_003641111.1.91683 WP_003641111.1.92145 WP_003641111.1.92629 WP_003641111.1.92717 WP_003641111.1.93143 WP_003641111.1.93409 WP_003641111.1.94382 WP_003641111.1.94656 WP_003641111.1.94667 WP_003641111.1.95302 WP_003641111.1.95345 WP_003641111.1.95554 WP_003641111.1.9589 WP_003641111.1.96838 WP_003641111.1.9731 WP_003641111.1.97443 WP_003641111.1.98090 WP_003641111.1.98190 WP_003641111.1.9834 WP_003641111.1.98401 WP_003641111.1.99274 WP_003641111.1.99945 YP_004888826.1.96219 gi|380031835|ref|YP_004888826.1| 220668.lp_0862 644042.JDM1_0718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]