SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G9H1J9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G9H1J9
Domain Number 1 Region: 12-120
Classification Level Classification E-value
Superfamily FlgN-like 1.09e-17
Family FlgN-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G9H1J9
Sequence length 148
Comment (tr|A0A0G9H1J9|A0A0G9H1J9_9GAMM) Flagellar biosynthesis protein FlgN {ECO:0000313|EMBL:KLD63079.1} KW=Complete proteome OX=1440762 OS=Dyella japonica DSM 16301. GN=Y882_13245 OC=Rhodanobacteraceae; Dyella.
Sequence
MSPSLQAELDHALTAAVDEMRLAVGQLMDALTTERTALENADVDALNHAGASKHELMVRL
EQLDSERVQLSQGAPEASRTLAPRWQEILQSLRACQQLNQRNGYLVGLRLQQVRKALAVL
TGNEAEASVYGRAGDLRTSLRSQSLAEA
Download sequence
Identical sequences A0A0G9H1J9
WP_046972355.1.16834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]