SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G9HX44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G9HX44
Domain Number 1 Region: 171-355
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.27e-69
Family Methylesterase CheB, C-terminal domain 0.000000617
Further Details:      
 
Domain Number 2 Region: 5-133
Classification Level Classification E-value
Superfamily CheY-like 8.11e-27
Family CheY-related 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G9HX44
Sequence length 356
Comment (tr|A0A0G9HX44|A0A0G9HX44_9XANT) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1440765 OS=Xanthomonas hyacinthi DSM 19077. GN=Y886_33370 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MTTTIKAMVVDDSAVVRQVLVAVLNEAPGIEVIAAAADPLLAMDKMRQQWPDVIVLDVEM
PKMDGITFLRKIMSERPTPVVICSTLTEKGARVTMDALAAGAVAVVTKPKLGLKQFLTDS
AEELVATVRSAARANVKRLAARNAAPPVEAEVKHSADVILPAQGGRPLAQTTERVIAIGT
STGGTQALEEVLTALPRVSPGIVIVQHMPEKFTAAFAARLDTLCHISVKEAANNDRVVPG
RALIAPGGKHMLLRRSGAQYFVEVVDGPPVNRHRPSVDVLFRSAARAAGANALGIIMTGM
GDDGAVGLLEMRQAGARTVAQDEQSSVVFGMPKEAIKRGGAEKILPLGSMAREIVQ
Download sequence
Identical sequences A0A0G9HX44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]