SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H0XZ48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H0XZ48
Domain Number 1 Region: 87-283
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.16e-52
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0000406
Further Details:      
 
Domain Number 2 Region: 11-86
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 4.84e-19
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H0XZ48
Sequence length 284
Comment (tr|A0A0H0XZ48|A0A0H0XZ48_VIBVL) Chemotaxis protein methyltransferase {ECO:0000256|PIRNR:PIRNR000410} KW=Complete proteome OX=1112911 OS=Vibrio vulnificus CladeA-yb158. GN=VVYB158_16995 OC=Vibrionaceae; Vibrio.
Sequence
MGRVLSSEVTLEPAQEFELTDKDFKYVQWFIHKHVGIFLSDHKRAMVYGRLSRKLREKGL
KRFADYRECIENNQDDRMAFINALTTNKTHFFREIHHVEFLESQLFPYWRDQRKKQVRIW
SAGCSTGEEPYSYLASIQQSGLWQAGVDCQLLATDLDTNVLQRAQQGIYEESALECIPTR
YLKGNFLRGKGVQAGNIKAKECLKQHVAFRQLNLLDAWPMKQKFDLISCRNVMIYFDKPT
QQRLIERFYHQLQDDGVLFLGHSESVGSDCQLFKHLGKTIYIKA
Download sequence
Identical sequences A0A0H0XZ48
WP_047111358.1.55006 WP_047111358.1.79678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]