SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H0YJE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H0YJE7
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 6.08e-17
Family H-NS histone-like proteins 0.00029
Further Details:      
 
Domain Number 2 Region: 93-135
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000000000471
Family H-NS histone-like proteins 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H0YJE7
Sequence length 135
Comment (tr|A0A0H0YJE7|A0A0H0YJE7_VIBAL) DNA-binding protein {ECO:0000256|PIRNR:PIRNR002096} KW=Complete proteome OX=663 OS=Vibrio alginolyticus. GN=AOG25_06235 OC=Vibrionaceae; Vibrio.
Sequence
MSELTKTLLNIRSLRAFSRELTLEQLEEALDKLTTVVDERREAEEAERAAQAEQEAKLAE
IAEKIAQDGIDVEALITALSGETKTKGKAKRAPRPAKYKYTDSNGNEKTWTGQGRTPSAI
QEQLDAGKSLDEFLI
Download sequence
Identical sequences A0A034TJU7 A0A061PJI6 A0A0H0YJE7 A0A2I3BYS4 D0X1F0
WP_005378185.1.100070 WP_005378185.1.11784 WP_005378185.1.1499 WP_005378185.1.15699 WP_005378185.1.18029 WP_005378185.1.18388 WP_005378185.1.23210 WP_005378185.1.24121 WP_005378185.1.31008 WP_005378185.1.33421 WP_005378185.1.43162 WP_005378185.1.4511 WP_005378185.1.47200 WP_005378185.1.49504 WP_005378185.1.51667 WP_005378185.1.54915 WP_005378185.1.5530 WP_005378185.1.58614 WP_005378185.1.59902 WP_005378185.1.6150 WP_005378185.1.63946 WP_005378185.1.70945 WP_005378185.1.77537 WP_005378185.1.82060 WP_005378185.1.82938 WP_005378185.1.86697 WP_005378185.1.86758 WP_005378185.1.88573 WP_005378185.1.97071 WP_005378185.1.99004 gi|543942097|ref|YP_008534553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]