SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H1RZV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H1RZV1
Domain Number 1 Region: 7-76
Classification Level Classification E-value
Superfamily XseB-like 2.35e-21
Family XseB-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H1RZV1
Sequence length 86
Comment (tr|A0A0H1RZV1|A0A0H1RZV1_BACPU) Exodeoxyribonuclease VII small subunit {ECO:0000256|HAMAP-Rule:MF_00337} KW=Complete proteome OX=1408 OS=Bacillus pumilus (Bacillus mesentericus). GN=XJ18_04075 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MTESNKQKEEQMTFEEAMKGLEEIVGKLEEGDVPLEQAIHYFQEGMTLSKLCHEKLQHVE
KQMDFILKEDGELAPFSVKEADAGEK
Download sequence
Identical sequences A0A0B4S9D3 A0A0H1RZV1
WP_039179863.1.23142 WP_039179863.1.35170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]