SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H1S0V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H1S0V4
Domain Number 1 Region: 164-353
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.53e-60
Family Methylesterase CheB, C-terminal domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 3.42e-29
Family CheY-related 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H1S0V4
Sequence length 357
Comment (tr|A0A0H1S0V4|A0A0H1S0V4_BACPU) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1408 OS=Bacillus pumilus (Bacillus mesentericus). GN=XJ18_03270 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MIRVLVVDDSAFMRKLISDFLSAEQEIEVVGTARNGEDALKRIKELNPDVVTLDVEMPVL
NGTEALKQILAEHDLAVIMVSSQTKQGKDLTIHCLELGAFDFVTKPSGSISLDLHKVRGQ
IVERVLAAGLSRKRTEEKVSPKPVIKPPSPVAAPRLQTVKGASLRKIISIGTSTGGPRAL
QRVVTKLPKDIEAPILIVQHMPAGFTASLAARLDHLSQITIKEAQDGDIAKNGVAYIAPG
GMNMSLHDQGGSLVIRLSPEDTESRHKPSVNYLFESISSIKGYEKIAVIMTGMGSDGTEG
VKKMVASGHTKVIAEKEESCVVFGMPKSVIKAGLAHETRHVDDIAHAIISSMKKERA
Download sequence
Identical sequences A0A0H1S0V4
WP_047202170.1.23142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]