SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H2LMA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2LMA0
Domain Number 1 Region: 166-351
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.18e-69
Family Methylesterase CheB, C-terminal domain 0.000000609
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 4.27e-28
Family CheY-related 0.00000661
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H2LMA0
Sequence length 355
Comment (tr|A0A0H2LMA0|A0A0H2LMA0_PRORE) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=587 OS=Providencia rettgeri. GN=AAY77_04420 OC=Morganellaceae; Providencia.
Sequence
MKKIKVLCVDDSALMRQLMREIINSHEDMEVVDTAPDPYVARDLIKQLEPDVITLDVEMP
RMDGIDFLEKLMRLHPMPVVMVSTLTSKGSEVTLNTLELGAVDFVTKPQIGIRETMMSYR
DIIGEKIRAAAMSKITQRSRFARPEKKVAEPVIQAKALSPYVCNSRVIAVGASTGGTEAI
RQFLEMLPRECPPVVITQHMPAGFTRSFADRLNKLCVLTVKEAENNELLQKGHAYIAPGD
SHMLIADKGKGFQVILQQSEPSHRHRPSVDVLFDSVAQCVGRKCIGVLLTGMGMDGAKGL
LNLRKQGAITYAQNESSCVVFGMPRAAIEMDAVDEVQDIRKIAPSVLARLSSVTV
Download sequence
Identical sequences A0A0H2LMA0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]