SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2LML0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2LML0
Domain Number 1 Region: 8-119
Classification Level Classification E-value
Superfamily HisI-like 4.32e-40
Family HisI-like 0.00039
Further Details:      
 
Domain Number 2 Region: 114-202
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 2.43e-23
Family HisE-like (PRA-PH) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H2LML0
Sequence length 203
Comment (tr|A0A0H2LML0|A0A0H2LML0_PRORE) Phosphoribosyl-ATP pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01019} KW=Complete proteome; Reference proteome OX=587 OS=Providencia rettgeri. GN=AAY77_03480 OC=Morganellaceae; Providencia.
Sequence
MLTSEQCSQLAWEKVDNLMPVIVQHAVSGDVLMLGYMTPEALQVTLDSRKVTFYSRTKQR
LWTKGETSNNFLNLQDIYPDCDSDTLLALALPDGPTCHNRTQSCFAPAQSDWGFLFELET
LLKERKTASPESSYTARLYASGTKRIAQKVGEEGVETALAATVNDRAELTNEAADLMYHL
LVLLQDQELDLSTIIKRLKERHQ
Download sequence
Identical sequences A0A0H2LML0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]