SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2QCK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2QCK3
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily YccV-like 1.44e-29
Family YccV-like 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H2QCK3
Sequence length 105
Comment (tr|A0A0H2QCK3|A0A0H2QCK3_9GAMM) Heat shock protein HspQ {ECO:0000256|HAMAP-Rule:MF_01194, ECO:0000256|SAAS:SAAS00634478} KW=Complete proteome OX=158849 OS=Moellerella wisconsensis. GN=VK86_04780 OC=Morganellaceae; Moellerella.
Sequence
MITSKFGIGQQVRHKLLGYLGVIVDVDAEYSLEQPQNDEISSNDTLRNAPWYHVVMEDDD
GEAIHTYLAEAQITYETYGDHPEQSSMDELAESIRSQLQAPRLRN
Download sequence
Identical sequences A0A0H2QCK3
WP_047255451.1.93926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]