SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H2X0Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2X0Q5
Domain Number 1 Region: 739-785
Classification Level Classification E-value
Superfamily MIR domain 0.000000366
Family MIR domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H2X0Q5
Sequence length 810
Comment (tr|A0A0H2X0Q5|A0A0H2X0Q5_CHLTA) MAC/perforin family protein {ECO:0000313|EMBL:AAX50406.1} KW=Complete proteome OX=315277 OS=HAR-13). GN=CTA_0162 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MTKPSFLYVIQPFSVFNPRLGRFSIDSDTYIEEENRLASFIESLPLEIFDIPSFMETAIS
NSPYILSWETTKDGALFTILEPKLSACAATCLVAPSIQMKSDAELLEEIKQALLRSSHDG
VKYRITRESFSPEKKIPKVALVDDDIKLIRNVDFLGRAVDIVKLDPINILNTVSEENILD
YSFTRETAQLSADGRFGIPPGTKLFPKPSFDVEISTSIFEETTSFTRSFSASVTFSVPDL
AATMPLQSPPMVENGQKEICVIQKHLFPSYSPKLVDIVKRYKREAKILINKLAFGMLWRH
RAKSQILTEGSVRLDLQGFTESKYNYQIQVGSHTIAAVLIDMDISKIQSKSEQAYAIRKI
KSGFQRSLDDYHIYQIERKQTFSFSPKHRSLSSTSHSEDSDLDLSEAAAFSGSLTCEFVK
KSTQHAKNTVTCSTAAHSLYTLKEDDSSNPSEKRLDSCFRNWIENKLSANSPDSWSAFIQ
KFGTHYIASATFGGIGFQVLKLSFEQVEDLHSKKISLETAAANSLLKGSVSSSTESGYSS
YSSTSSSHTVFLGGTVLPSVHDERLDFKDWSESVHLEPVPIQVSLQPITNLLVPLHFPNI
GAAELSNKRESLRQAIRVYLKEHKVDEQGERTTFTSGIDNPSSWFTLEAAHSPLVVSTPY
IASWSTLPYLFPTLRERSSATPIVFYFCVDNNEHTSQKILNQSYCFLGSLPIRQKIFGSE
FASFPYLSFYGNAKEAYFDNTYYPTRCGWIVEKLNTTQDQFLRDGDEVRLKHVSSGKYLA
TTPLKDTHGTLTCTTNCEDAIFIIKKSSGY
Download sequence
Identical sequences A0A0H2X0Q5
gi|237802582|ref|YP_002887776.1| 315277.CTA_0162 580049.JALI_1521 672161.CTB_1521 WP_011324600.1.17422 WP_011324600.1.31128 WP_011324600.1.43504 WP_011324600.1.6151 WP_011324600.1.61683 WP_011324600.1.62239 WP_011324600.1.62968 WP_011324600.1.65182 WP_011324600.1.71686 WP_011324600.1.72164 WP_011324600.1.92427 WP_011324600.1.93600 gi|478458697|ref|YP_007731881.1| gi|76788868|ref|YP_327954.1| gi|237804500|ref|YP_002888654.1| gi|478448769|ref|YP_007723692.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]