SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2X5U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2X5U0
Domain Number 1 Region: 303-482
Classification Level Classification E-value
Superfamily DNA-glycosylase 7.85e-45
Family DNA repair glycosylase, 2 C-terminal domains 0.0001
Further Details:      
 
Domain Number 2 Region: 2-84
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 1.07e-29
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00036
Further Details:      
 
Domain Number 3 Region: 197-295
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.82e-27
Family DNA repair glycosylase, N-terminal domain 0.0035
Further Details:      
 
Domain Number 4 Region: 138-188
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000851
Family AraC type transcriptional activator 0.016
Further Details:      
 
Domain Number 5 Region: 87-133
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000116
Family Tetracyclin repressor-like, N-terminal domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H2X5U0
Sequence length 487
Comment (tr|A0A0H2X5U0|A0A0H2X5U0_XANC8) DNA methylation and regulatory protein Ada {ECO:0000313|EMBL:AAY48533.1} KW=Complete proteome OX=314565 OS=Xanthomonas campestris pv. campestris (strain 8004). GN=XC_1465 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MHTAMPDRTHCDCARLARDARFDGLFFTAVRSTGIYCRPVCPAPPPKPSNISYYPTAAAA
TAAGYRPCLRCRPELSPQAQQHLGEESVQRALAMIAEGALQEQPVQTLADAVGMSARQLQ
RQFVQQLGATPIQVHGTRRLLLAKQLLTETALPVTEVALAAGFNSLRRFNAAFLQGCGMP
PSALRKQRSDVPGGDLCLRLGYRPPLDLPAMLTFLQRRAIPGIEQVDADGYRRVIGAPGQ
ATLIHVSAAPTRDELLLRIGATDPRQIPQIVRRVRRIFDLDADLHAVHATLAQDPLLEQA
ITRRPGLRVPGGWDGFEVAVRAVLGQQISVAGAATLAARLVDRHGGHLPDMPPGLDRSFP
TPAQMADAPLEQLGLPRARAATLRALASACAQGRLHFGAGQRLPDFVAACTALPGIGPWT
AHYIAMRALSHPDAFPAGDLILQQVLGAPERLSERATEARSQAWRPWRAYAVLHLWHLAV
DRKDTRS
Download sequence
Identical sequences A0A0H2X5U0 Q8P7F9
NP_638000.1.47755 WP_011037782.1.10627 WP_011037782.1.12496 WP_011037782.1.16446 WP_011037782.1.1732 WP_011037782.1.18295 WP_011037782.1.22538 WP_011037782.1.27778 WP_011037782.1.31612 WP_011037782.1.40219 WP_011037782.1.4502 WP_011037782.1.475 WP_011037782.1.56666 WP_011037782.1.82601 XcR302 gi|21232083|ref|NP_638000.1| gi|66767791|ref|YP_242553.1| 190485.XCC2652 314565.XC_1465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]