SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H3BIU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3BIU1
Domain Number 1 Region: 210-396
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-64
Family Methylesterase CheB, C-terminal domain 0.00000355
Further Details:      
 
Domain Number 2 Region: 6-129
Classification Level Classification E-value
Superfamily CheY-like 6.69e-29
Family CheY-related 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3BIU1
Sequence length 403
Comment (tr|A0A0H3BIU1|A0A0H3BIU1_TREPS) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=455434 OS=Treponema pallidum subsp. pallidum (strain SS14). GN=TPASS_0631 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MKNTNDIAVLIVDDSALMRKVIGKVIEGAPGLSIAGKAMNGRFALDMLERVQPDVILLDL
EMPHMNGLQFLEQRKRLRIDIPVIILSSIAKEGARVTMQCLELGASDFVTKPFGSESAHL
RTVSRKIVDYVTAYGRRYKLLRRTRRCLAMDTPVERPAGEEDLNCLDTQERASLPSVCAR
APARDRASYTITPTEGARQTRIVPLRESGALQIIAIGVSTGGPSALRHIFAQLDADLPQP
VVVVQHMPAGFTREFAYSLNQVCALEVKEAQEGDLVRRGRVLIAPGDRHLTVERRSLATV
AHINSDEPENGHRPSVDVLFESVARHFENRALGILMTGMGRDGAAQLARLYTEGSRTIAQ
DADSCIVYGMPRVACELGAVGEQVSLDDMAATINRYGKVFASS
Download sequence
Identical sequences A0A0A7X570 A0A0H3BIU1 O83639 R9UTG9
gi|378975263|ref|YP_005223872.1| gi|189025857|ref|YP_001933629.1| gi|512444086|ref|YP_008119365.1| gi|408502494|ref|YP_006869938.1| WP_010882077.1.101681 WP_010882077.1.10609 WP_010882077.1.11013 WP_010882077.1.13630 WP_010882077.1.177 WP_010882077.1.22706 WP_010882077.1.24110 WP_010882077.1.24144 WP_010882077.1.26337 WP_010882077.1.28216 WP_010882077.1.31174 WP_010882077.1.34567 WP_010882077.1.35526 WP_010882077.1.38137 WP_010882077.1.38252 WP_010882077.1.38852 WP_010882077.1.39803 WP_010882077.1.41302 WP_010882077.1.42739 WP_010882077.1.42752 WP_010882077.1.43796 WP_010882077.1.44774 WP_010882077.1.45335 WP_010882077.1.49513 WP_010882077.1.50901 WP_010882077.1.51333 WP_010882077.1.6132 WP_010882077.1.61389 WP_010882077.1.63356 WP_010882077.1.72815 WP_010882077.1.78381 WP_010882077.1.82112 WP_010882077.1.89996 WP_010882077.1.90600 WP_010882077.1.90779 WP_010882077.1.92130 WP_010882077.1.98226 WP_010882077.1.98956 WP_010882077.1.99137 WP_010882077.1.99367 gi|15639619|ref|NP_219069.1| 243276.TP0631 455434.TPASS_0631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]