SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3E3Y5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H3E3Y5
Domain Number - Region: 176-212
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 0.0445
Family P-domain of calnexin/calreticulin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3E3Y5
Sequence length 264
Comment (tr|A0A0H3E3Y5|A0A0H3E3Y5_BACA1) Uncharacterized protein {ECO:0000313|EMBL:ADP33053.1} KW=Complete proteome; Reference proteome OX=720555 OS=Bacillus atrophaeus (strain 1942). GN=BATR1942_10610 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKQQEVHQFLLRFFQANSCPIIDQGPGHMTVQLTVEMDKQIMNRPFYWHWREKTGGEPNP
MKITFITDKDAAPEDLDGEFIYFGAPRLFEIFKAVKQNGRFIRMYEKIESAGAKIPLQPW
LGLNVMISYQSDMKKDKLLSLGLHLVSGKMVEDFQRKLTTHSLASQISDYCFTMSPMIKP
ESGLKRMEHYITQAALQEPSDWAEASVKRWKNDLQLLDQFYEDTEEKPEEYHLEKQALQT
LYKPKILVHIENGGLFFLQNNIPS
Download sequence
Identical sequences A0A080UQA6 A0A0H3E3Y5 A0A150KR10
gi|311069061|ref|YP_003973984.1| WP_003325443.1.100936 WP_003325443.1.10353 WP_003325443.1.15971 WP_003325443.1.16994 WP_003325443.1.30485 WP_003325443.1.32777 WP_003325443.1.39473 WP_003325443.1.39900 WP_003325443.1.40255 WP_003325443.1.45236 WP_003325443.1.48649 WP_003325443.1.53439 WP_003325443.1.59507 WP_003325443.1.62747 WP_003325443.1.68581 WP_003325443.1.69262 WP_003325443.1.70004 WP_003325443.1.72589 WP_003325443.1.72801 WP_003325443.1.7305 WP_003325443.1.7508 WP_003325443.1.79721 WP_003325443.1.94463 WP_003325443.1.96443 WP_003325443.1.99425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]