SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H3F8A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3F8A6
Domain Number 1 Region: 156-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.8e-76
Family Methylesterase CheB, C-terminal domain 0.0000000265
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 6.69e-28
Family CheY-related 0.00000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3F8A6
Sequence length 349
Comment (tr|A0A0H3F8A6|A0A0H3F8A6_RAHSY) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=741091 OS=Rahnella sp. (strain Y9602). GN=Rahaq_1833 OC=Yersiniaceae; Rahnella.
Sequence
MNKIRVLSVDDSALMRQLMTEIINSHPDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEITLRALELGAIDFVTKPQLGIREGMLAYS
EMIADKIRTASKARLNKSVNIDQPRILSHTPLLSSEKLIAIGSSTGGTEAIRHVLQPLPP
TCPALMITQHMPPGFTRSFADRLNKLCQITVKEAEDGERVLPGHAYIAPGDRHMELTRSG
ANYQVKLNDGPAVNRHRPSVDVLFRSVAQFAGRNAVGVILTGMGNDGAAGMLEMHRAGAY
TLAQNEASCVVFGMPREAIATGGVNEVVDLSQISQRMLAQISAGQALRI
Download sequence
Identical sequences A0A0H3F8A6 H8NT34
gi|384257666|ref|YP_005401600.1| WP_013575153.1.59798 WP_013575153.1.73690 WP_013575153.1.91760 gi|322832551|ref|YP_004212578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]