SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3FZB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3FZB9
Domain Number 1 Region: 5-94
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 2.48e-32
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.0000327
Further Details:      
 
Domain Number 2 Region: 270-350
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 3.66e-29
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0000231
Further Details:      
 
Domain Number 3 Region: 190-269
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase domain 1.16e-19
Family Methylated DNA-protein cysteine methyltransferase domain 0.00026
Further Details:      
 
Domain Number 4 Region: 87-135
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000179
Family AraC type transcriptional activator 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H3FZB9
Sequence length 356
Comment (tr|A0A0H3FZB9|A0A0H3FZB9_KLEAK) Bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase {ECO:0000313|EMBL:AEG99732.1} KW=Complete proteome; Reference proteome OX=1028307 OS=aerogenes). GN=EAE_24195 OC=Enterobacteriaceae; Klebsiella.
Sequence
MKPMIADMTNDDRCWQAVCERDASADGQFVFAVLTTGVCCRPSCRSRRALRENVRFYADV
EAAKAAGYRPCKRCRPDNLDPDQQRVEKVAAACRLLEQEAPITLEALAQQLAVSPFHFHR
IFKSVTGLTPKAWQQAWRARRLREALSHGQNVTSAALAAGFPDSASYYRQANETLGMTAR
QFKRGGEDILISWVCCNSASGRCLVAFSERGVCAVLLGDDDKALYAELASLFPGAQLQPG
DDTFTERVAQVVAHLDNPQQAVNLPLDIRGTAFQQRVWQALRQIPAGETRSYREVAHSIG
QPRAVRAVAGACAANKLAIVIPCHRVVREGGALSGYRWGSERKALLLAREAKMREK
Download sequence
Identical sequences A0A0H3FZB9
WP_015706139.1.35711 WP_015706139.1.39864 WP_015706139.1.64517 WP_015706139.1.71213 YP_004595011.1.85618 gi|336251301|ref|YP_004595011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]