SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3JAM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3JAM2
Domain Number 1 Region: 44-243
Classification Level Classification E-value
Superfamily YojJ-like 8.11e-69
Family YojJ-like 0.0000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3JAM2
Sequence length 281
Comment (tr|A0A0H3JAM2|A0A0H3JAM2_CLOPA) Cyclic-di-AMP synthase {ECO:0000256|HAMAP-Rule:MF_01499} KW=Complete proteome; Reference proteome OX=1262449 OS=Clostridium pasteurianum DSM 525 = ATCC 6013. GN=CLPA_c36120 OC=Clostridium.
Sequence
MDIINILVAAVKSLSIWSILDIMVVTYIFYKGYMLIKETRAEQLLKGILLILLLMPVSNF
LHLTMLNWILERTITIGVLSIIIIFQPEIRRALEHLGRTAFNDVHILENKEKMEEVITQI
VNAVYNLSKTRTGALIVMEQRTKLEDIMSTGTKIEGIVSSAILENIFVVNTPLHDGATII
RNDRILASGCFLPLSSNYDISKKLGTRHRAALGISENSDAIVIVVSEETGVVSLAINGKL
TRGYTKDKLKDILIRIILIRFSKNNSFKEKVKMWRRKPNSK
Download sequence
Identical sequences A0A0H3JAM2 A0A1D9N7M3
WP_003445693.1.15649 WP_003445693.1.61834 WP_003445693.1.63412 WP_003445693.1.65006 WP_003445693.1.70023 WP_003445693.1.82391 WP_003445693.1.85023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]