SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3M0K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H3M0K4
Domain Number - Region: 65-139
Classification Level Classification E-value
Superfamily Chondroitin AC/alginate lyase 0.0394
Family Hyaluronate lyase-like catalytic, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H3M0K4
Sequence length 181
Comment (tr|A0A0H3M0K4|A0A0H3M0K4_EHRRW) Uncharacterized protein {ECO:0000313|EMBL:CAI27260.1} KW=Complete proteome OX=254945 OS=Ehrlichia ruminantium (strain Welgevonden). GN=ERWE_CDS_07660 OC=Anaplasmataceae; Ehrlichia.
Sequence
MLFFYHFYKEILMYGNITSVISSNNNTLAPLFNTKTTIDNNTDSLLPIIISISGVLLVIG
IIMSWYTRKCIRENALTTRSSISLATYRSTRSVETIEEDNNDFDSIETYSRDHNYHALTI
EDDDDDLEFLNVKLQWIEETDPNYRHYVLNNMEGEEMDDNTAFQISSVRLPYQSNNTQKK
L
Download sequence
Identical sequences A0A0H3M0K4
gi|58579430|ref|YP_197642.1| gi|58579430|ref|YP_197642.1| WP_011155406.1.14124 WP_011155406.1.54455 254945.Erum7280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]