SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3U597 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3U597
Domain Number 1 Region: 16-352
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 7.33e-130
Family Bacterial photosystem II reaction centre, L and M subunits 0.00000000000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3U597
Sequence length 353
Comment (tr|A0A0H3U597|A0A0H3U597_9GENT) Photosystem Q(A) protein {ECO:0000256|HAMAP-Rule:MF_01383} OX=50768 OS=Gentiana straminea. GN=Genstr_Cp016 OC=Gentianeae; Gentiana.
Sequence
MTIALGKFTKDETDLFDTMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY
THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA
FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF
RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ
AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV
SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Download sequence
Identical sequences A0A0H3U597 A0A0H3U6C8 A0A173ACG7 A0A1B0RX02 A0A222AH14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]