SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3VN35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3VN35
Domain Number 1 Region: 36-203,266-285
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 1.7e-95
Family Cytochrome f, large domain 0.0000000137
Further Details:      
 
Domain Number 2 Region: 203-265
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 2.98e-20
Family Cytochrome f, small domain 0.0000646
Further Details:      
 
Domain Number 3 Region: 282-320
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00000000000000196
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3VN35
Sequence length 320
Comment (tr|A0A0H3VN35|A0A0H3VN35_ROYRE) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=145709 OS=Roystonea regia (Cuban royal palm). GN=petA OC=Roystoneeae; Roystonea.
Sequence
MQNRNTFSWVKEQMTQSISVSIMIYVITRASISNAYPIFAQQGYENPREATGRIVCANCH
LANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKKGALNVGAVLILPEGFELAP
PDRISPEVREKMGNLSFQSYRPNKRNILVIGPVPGQKYSEIAFPILSPDPATRKDVHFLK
YPIYVGGNRGRGQIYPDGSKSNNTVYNATSAGIVSRIVRKEKGGYEITIVDASDGHQVVD
IVPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQ
VFLVLKKKQFEKVQLYEMNF
Download sequence
Identical sequences A0A0H3VMH6 A0A0H3VMM4 A0A0H3VN35 A0A0H3VN89 A0A0H3VNH3 A0A0H3VPX8 A0A0H3VR53 A0A0H3VR90 A0A0H3VRJ3 A0A0H3VRS1 A0A0H3VRX0 A0A0H3VS45 A0A0H3VS75 A0A0H3VSP2 A0A0H3VSW0 A0A0H3VTD4 A0A0H3VUM1 A0A0U3DUN4 A0A143FU55 A0A2I7YVN1 A9QB88 I1E3W2 M1JXN8 T1SCN9
YP_006073117.1.75690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]