SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4LB37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4LB37
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily XseB-like 6.54e-19
Family XseB-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H4LB37
Sequence length 78
Comment (tr|A0A0H4LB37|A0A0H4LB37_9LACO) Exodeoxyribonuclease VII small subunit {ECO:0000256|HAMAP-Rule:MF_00337} KW=Complete proteome; Reference proteome OX=1612 OS=Lactobacillus farciminis. GN=ABB44_08670 OC=Lactobacillus.
Sequence
MAEEKKTFEENLADLEEIVKNLETGNVPLEEAMEKFKKGVTLSKELEKTLSEAEETVTKI
MTKDGQEVNMKNDQSKDE
Download sequence
Identical sequences A0A0H4LB37
WP_059073574.1.76703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]