SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H4P5L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4P5L6
Domain Number 1 Region: 221-398
Classification Level Classification E-value
Superfamily MIR domain 5.41e-40
Family MIR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1092-1220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.8e-20
Family SPRY domain 0.035
Further Details:      
 
Domain Number 3 Region: 671-806
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000211
Family SPRY domain 0.073
Further Details:      
 
Domain Number 4 Region: 104-188
Classification Level Classification E-value
Superfamily MIR domain 0.0000000549
Family MIR domain 0.019
Further Details:      
 
Domain Number 5 Region: 4212-4271
Classification Level Classification E-value
Superfamily EF-hand 0.0000000818
Family Polcalcin 0.053
Further Details:      
 
Domain Number 6 Region: 2254-2344
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000118
Family IP3 receptor type 1 binding core, domain 2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H4P5L6
Sequence length 5134
Comment (tr|A0A0H4P5L6|A0A0H4P5L6_CARSA) Ryanodine receptor {ECO:0000313|EMBL:AKP49172.1} OX=252295 OS=Carposina sasakii (Peach fruit moth) (Carposina niponensis). GN= OC=Copromorphoidea; Carposinidae; Carposina.
Sequence
MAEAEGGASEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDL
SQCVFVIEQALSVRALQELVTAAGSETGKENLGKGTGSGHRTLLYGNAILLRHLNSDMYL
ACLSTSSSQDKLAFDVGLQEHSQGEACWWTLHPASKQRSEGEKVRVGDDLILASVATERY
LHTTKENEISIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPST
WSKEGGQNIVVYEGGSVMSQARSLWRLELARTKWAGGFINWYHMMRIRHITTGRYLAVNE
TNELYLVSRDEATTALCAFCLRQEKDDRKVVLEDKDLEVIGSPIIKYGDSTVIMQHSETG
LWLSYKSYETKKKGLGKVEEKQAILHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFTK
FINGLEALQENRRHSLFFASVNLGEMVMCLEDLINYFAQPDEDMEHEEKQNKLRALRNRQ
DLFQEEGILNLILEAIDKINVITSQGFLAGFLAGDESGQSWEMISGYLYQLLAAIIKGNH
TNCAQFANSNRLNWLFSRLGSQASGEGTGMLDVLHCVLIDSPEALNMMRDEHIKVIISLL
EKHGRDPKVLDVLCSLCVGNGVAVRSSQNNICDYLLPGKNLLLQTQLVDHVSSVRPNIFV
GRVEGSAVYQKWYFEVTMDHIEKTTHMMPHLRIGWANTTGYVPYPGGGEKWGGNGVGDDL
YSFGFDGAFLWSGGRKTPVNSTHPQEPYIRKSDVIGCALDLTVPIINFMFNGVRVTGSFT
NFNLEGMFFPVISCSSKLSCRFLLGGEHGRLRYAAPEGYSPLVESLLPQQILCLEPCFYF
GNLAKRAIAGPPLVQDDTAFVPTPVDTMAITLPTYVEQIRDKLAENIHEMWAMNKIEVGW
MYGEQRDDLHKIHPCLVPFERLPAAEKRYDIQLAVQTLKTILALGYYISLDKPPARIRNV
RLPHEPFMQSNGYKPAPLDLSAVTLTPKMDELVDQLAENTHNLWARERIQQGWTYGLNED
PDMHRSPHLVPYPKVDDAIKKANRDTASETVRTLLVYGYNLEPPTGEQHEALLLEASKLK
QADFRTYRAEKNYAVSSGKWYFEFEILTAGPMRVGWAHADMAPGMMLGQDENSWAFDGFN
CVKMHGGSSDIFGQQFKIGDIVGCFLDVFDQTISLSLNGELLMDALGGETTFADVQGDNF
VPACTLGVGQKCRLTYGQDVNSLKYFTTCGLQEGYEPFCVNMNRPVTHWYTKDQPIFENT
DEMADTRIDVTRIPAGSDTPPCMKISHNTFETMEKANWEFLRLSLPVICHAQFIDEHEKA
RRWIEIKERQQILMKEAVEAQMPAHIDQIMRSGFTMNDIKGMHYEEDMSSSKIKRQPSKP
PRKGSIPRGLQPGQTNGMHRSTREAEMAKYELTPGVDDKKEKRGRSPFKFFKSKRGESSD
RAKARKSKTPDPFSDTKVSPERGLARRPNPQIRVSQANQRYNDMPSRPSRPNLYGSQTGL
NTNLTTSTPTQDRKQMTSSALTAATTETVGNEIFDAECLKLINEYFYGVRIFPGQDPTHV
YIGWVTTQYHLHSKDFNQNKVMKSSVIITDDYDRVVESVNRQSCYMVRADELYNEVMADA
TAKGASQGMFIGCSVDTSTGTVSFTCEGKDTSIKFKMEPETKLFPAIFVEATSKEILQIE
LGRSLTSLPLSAAVLPTSDKHVIPQFPPRLKVQCLKPHQWARVPNQSLQVHALKLSDIRG
WSMLCEDAVSMLALHIPEEDRCIDILELIEMDKLLSFHSHTLTLYAALCYQSNYRAAHAL
CQHVDQKQLLYAIQSQYMSGPLRQGFYDLLIALHLESHATTMEVCKNEFVIPLGPELKAL
YDDPEMGHSLRSLQTESVRPQMKMTDIAENISDISNLYSPYFPLEVVREFVMQALAEAVE
TNQVHNRDPVGGTNENLFLPLIKLVDRLLLVGMMRDEDVEKLLIMINPETWDPTFDKEGK
DEHRKGLLHMKMAEGAKLQMCYLLHHLNDTQLRHRVESIIAFAHDFVGDLQTDQLRRYIE
IKQSDLPSAVAAKKTREYRCPPREQMNAILSFKHLEEDDSENMPCGEDLITRMLSFHDSL
MVHVSLNALQEPDPGESTEPETKPGAIGKIYNIINTVKELEEEPKAIEEPPKKSPEEKFR
KVLIHTMVSWAEESQIETPKLVREMFSLLVRQYDAVGELIRALEKTYVINAKTKLDVAEM
WVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNHTFFQHPDLIRVLRVHENVMAVMMNTL
GRRAQAQSDAQPTNPETKTEDKEKDTSHEMVVACCRFLCYFCRTGRQNRKAMFDHFDFLL
ENSNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAIYLSRCGLQSNSELVE
KGYPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGL
LKAIVDANKMSERIADRRKLREMEQEGDVTQAPRPGEFSHPLPESDEDEDYIDAGAAILN
FYRTLVDLLGRCAPDASVIALGKNESLRARAILRSLVPLEDLQGVLSLRFTLNNPAAGEE
RPKSDMPSGLIPGHKQSVGLFLERVYGIETQELFYRLLEEAFLPDLRAATMLDRNDGCES
DMALSMNRYIGNSILPLLIKHAYFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVS
DFLVALTSAMQPSMLLKLLRKLTVDVSRLSEYTTVALRLLTLHYERCAKYYGSTGGQGVY
GASSDEEKRLTMMLFSNIFDSLSKMDYDPELFGKALPCLIAIGCALPPDYSLSKNYDDEF
YGKEQATGSADNPQYDPQPINTSSVALNNDLNTIVQKFSEHYHDAWASRKIENSWVYGES
WSDTHKSHPRLEPYNMLNDYEKERYKEPVRESLKALLAIGWSVEHSEVDIPSTNRSSMRR
QSKSGGQSGPLVADSATPFNYNPHPVDMTNLTLSREMQNMAERLADNAHDIWAKKKKEEL
TVNGGGIHPQLVPYDLLTDKEKKKDRERSQEFLKYLQYQGYKLHRPSKASQSDTEQTTAG
VATPELRFAYSLLEKLIQYIDRATINMKLLKPSTTFSRRSSFKISTRDIKFFSKVVLPLM
EKYFSTHRNYFIAVATATNNVGAASLKEKEMVAALFCKLASLLRSRLAAFGPDVRITVRC
LQVLVKGIDAKSLVKNCPEFIRTSMLTFFNNVADDLGHTILNLHEGKYAHLRGTHLKTST
SLGYINGVLLPILTAMFDHLANCEYGADLLLDEIQVASYKMLGSLYSLGTDASLTQDRKY
LKTEIERNKPALGSCLGAFSSTFPVAFLEPHLNKHNQFSLLNRIADHSLEAQDIMAKMEQ
SMPTLEMILSEVDQFVESDKAYNEAPHIIDVILPLLCSYLPFWWAQGPDNTSPTAGNHVT
MVTAEHMNQLLKNVLKLIKKNIGNESAPWMTRIATYTQQIIINSSEELLGDSFLPLAERV
RKRTDNMFHKEESLRGFIKSSTDDTSQVESQIQEDWQLLVRGIYSFYPLLIKYVDLQRNH
WLRNNVPEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMVLIMPTATRRVTTVV
DGAPQGSGKKKKKHRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRF
LKKMTEQDVCEFAKTQLTLPDKIDPGDEMSWQHYLYSKLGSKSKTAVTDNTAENKAKIID
DTVERIVAMSKVLFGLHMIDHPQQMSKNVYRSVVSIQRKRAVIACFRHLPLHSLTRHRAC
NIFARTYYELWLAEENVGQEVMIEDLTQSFGDAELKKSEASEEEGKPDPLTQLVTTFCRG
AMTERSGALQEDALYMSYADIIARSCGEEEEEGGEEEEEGGGEAVGEEEGKASIHEQEME
KQKLLFHQARLADRGVAEMVLLHISASKGVPSDMVMKTLQLGISILRGGNIEIQMGMLNH
LKDKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGLEGAAGEKNMHDAEFTCALF
RFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELIDP
AGKANFFKAIGVASQVFNTLTEVIQGPCTQNQQALAHSRLWDAVGGFLFLFSHMQDKLSK
HSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMF
LKLKDLTSSPSFQEIDGNNDGWVLPKDFKDKMEQQKSYTPEEIEFLLACCETNHDGKLDY
IGFCDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEIMG
GTKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEM
THASGLMAASEETSGGTKNREAAYMYMGDDDDERAGKDPFRRGLQSVKDGISTAFSSLSP
SNIKAKIADMQQMPPAELAVGFFKLFFYMFYYMGYSVLVVVRYIFGVLLGLMRGPQLEEP
PPEPTEEEKIGQLRLRLLHQQSPIRHLPALPAADDTGQLQVSAFGLDITKEEGQVQVKPH
ESPTTSSPSSGEEAEIPSDEAAEHTEEHQPPSLIDLLGGEQAKKQAQERMEAQAVQQAAM
SAIEAESKKAVQGPAPSALAQVDLSQYTRRAVSFLARNFYNLKYVALVLAFCINFVLLFY
KVSTLDDDNAEGSGLGDLMGGSGGSGSGSGSGDGSGESGEDDDPLEIVHIDEDFFYMEHV
INIAAVMHSVVSLAILIGYYHLKVPLAIFKREKEIARKLEFDGLYIAEQPEDDDLKSHWD
KLVISAKSFPVNYWDKFVKKKVRAKYSETYDFDSISNMLGMEKTSFAAQEEDSSKGLFYY
IINIDWRYQVWKAGVTFTDNSFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTIL
QSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYVQEEDDEVNRNCHDMLTCFVFNLY
KGVRAGGGIGDELEPPDGDDSEVYRIIFDISFFFFIIVILLAILQGLIIDAFGELRDQLE
SVKENMESNCFICGIGKDYLDIVPHGFDTHVQREHNPANYMFFLMHLINKPDTEYTGQET
YVWNMYTQRCWDFFPVGDCFRKQYEDVMGESQAK
Download sequence
Identical sequences A0A0H4P5L6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]