SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4TDK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4TDK1
Domain Number 1 Region: 15-87
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.00000000000000114
Family Interleukin 8-like chemokines 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H4TDK1
Sequence length 111
Comment (tr|A0A0H4TDK1|A0A0H4TDK1_ICTPU) Interleukin-8 {ECO:0000313|EMBL:AKQ06246.1} OX=7998 OS=Ictalurus punctatus (Channel catfish) (Silurus punctatus). GN= OC=Ictaluridae; Ictalurus.
Sequence
MKAATLTVLPLIIFALTAILCEGWGEGKAERCFCQKKALEKVRPALVKKFEVFPPSASCS
NTGIILSLKQGMKVCLDPEGNQGQKVLTGQKLKIKSKGRRGKKQKKIKQQN
Download sequence
Identical sequences A0A0H4TDK1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]