SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H5RAD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H5RAD6
Domain Number 1 Region: 13-92
Classification Level Classification E-value
Superfamily MIR domain 0.000000000123
Family MIR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H5RAD6
Sequence length 144
Comment (tr|A0A0H5RAD6|A0A0H5RAD6_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:CRZ11038.1} OX=70186 OS=Spongospora subterranea. GN= OC=Plasmodiophoridae; Spongospora.
Sequence
LQRIFVLSVDCNCCQVSCFGNDAGSDSGDNWKVVCSETFWGRKTVVEFLHVDTQKYLAMK
QNSMYTNANCPQCPIIGQLEVFCQGQSNRDTKFKVRISVSVLWKADERHCFQAAEGIYHR
LPTQDDVEVEDDDDSSGENYERDL
Download sequence
Identical sequences A0A0H5RAD6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]