SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H5S2G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H5S2G8
Domain Number 1 Region: 281-482
Classification Level Classification E-value
Superfamily MIR domain 8.63e-48
Family MIR domain 0.0000185
Further Details:      
 
Domain Number 2 Region: 484-654
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.2e-44
Family IP3 receptor type 1 binding core, domain 2 0.00000901
Further Details:      
 
Domain Number 3 Region: 1218-1377
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.62e-28
Family IP3 receptor type 1 binding core, domain 2 0.0047
Further Details:      
 
Domain Number 4 Region: 142-215
Classification Level Classification E-value
Superfamily MIR domain 0.000000000863
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H5S2G8
Sequence length 2850
Comment (tr|A0A0H5S2G8|A0A0H5S2G8_BRUMA) BMA-ITR-1 {ECO:0000313|EMBL:CRZ22404.1, ECO:0000313|WBParaSite:Bm3788} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=BM_Bm3788 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MLRNQHRLYNNKLSIAMSLDTFHNTSLHIGDVISLYAEDYSRPVEDRLEERLFPRTGFLS
TLGLVDDRCIVEIGNGTPDSPPKKFRDCLFRVCPINRYAAQKQFWTEQKKFQVGESLFEE
DMLKKLKHAADKEKEQNDMEYKKMLGANVQYGGTIQLLHVKSDKYLTVLKNSPAKLERNA
MKVYLDKNGHEGSWFYVEPVYKHSFFGDNVNGGDRISLVPYSYCPIPNTTGHVKPQLHLS
HLSLPDHPIGFEVNCSNELTEWQVLMFLQFDENQENIVKSGDVVRLFHAEQQTFLTLDTV
PKTNKDAVFLRLTNRPSAADATSSRALWEIQVVQFDSYRGAAASWLREFRFKHLATDMYL
SVERMRLNKTENTPTNTVSSLPEAEYCDDGQYYLVPKHSEKPETDESLLFVLDPCTFTKM
DARISQRTYVRLWHVCTNTWIHTTDPTEKQNLYHFSSNEKGWVKVVSENFKIDKETFALL
PVRPDEVRDLDFANDACKALNGFVKLIRSGMIISKEPMNVTIQLLTECIFFVTNQSNHVT
DPIKIVDFKPPRDRQKLLREQGVLDQVFALLRAPFLPRNGIDPEPLLCSPRKLSEKGNEI
FKQIFHLCYSLLRYSQVGYRKNQEYLAEKFGQIQEQIGFDLLAEDTMTAVLHNNPKLLEK
YVKNPHVERFVELVRNNKDGRFLVYLADLCVCRGEANKKIQELICNCVLNEVNRDIFIRT
IIYDKSSNEVWICWSNSYCKQLVSVAMDAAKGQTEDIEVLDYYKHQLDLLAQMCHDQQYL
AIDPPPERRLLNLSLELPADLVLRCISDTRLPQDLRASFARLMLHLHVIRGSPLNAVHHA
RLWREIPLNSTVSGNSSRCVNGYVDSGYVRSGGEVFDKVLKTVDVYLEELRKTTREGEPV
LDPSLSKLKQNRLTFEIVTLARALAHFEFYSFADLLRLAQNLLAIADSSPKKPEDKMAFD
KTGLFRHVTYSVIGANALQKGAKQYLQHMKTESACNENTLQVKESKQMVLQTKLIIVEIL
NFIMDIRRDYRITVALSWFKKHFPCDELGELLSKTDLSEHEASELYKEVFQNCEENLDFD
GRNGQLLLRILLQMTISDFSKLTSTALIVMFRHFTQYQEFVEDLKQVQLLVSNDDVENYQ
QIDRDLFILKILTEKSELWVQADKTRPESSSKLSFEEHGSSLDDSSKLLLSIRATSQQLE
DSGLNATCAFHNNESFLSLVEKIEQHYYFARDECIKLLCKLLLGDDRTEAASALYELFDR
APLVCYPLVRQILYRVKQLCYKNDKPNKMNQQLLRNMRVHEYVLGFLSVPYDEKNDAEMP
KLVTLSHEFLRSFCRNNIENQFRLYKHVSIEQDAKEGCLRVDTMEEVATLTAIFKNNRIL
CQNVSEEVIAHIVNMIEHKARSSVYIEFLQTVVMVQAKEIKSAQEKVAQEICSSSDDVRV
YYADSASFEQLKQLMHNTGPEDLTSDHPLRYHIDLVRLLALCTRGRNSTTELKCASQLSM
DHIVRVLTIPYCLIQVKDAYLQFMLHCYIDADAEMKDVDNVDFIERIMKNIFSDIQMYIA
SLSQMKMEKLTLLPNSAFEKYVCYTATEVLVKLFERPSAYQLIVEISQQHQFFSRMIQSL
CRLQEELVRKCFTKNWYRVAECVRRLSRRAEENGVILSINGYMQPGYTEATVKQRWQSAF
NSARFINQTNKCAKTRLHVPRYVQVAESFSSVVSCYQAMVNEFKVFALPLQTAETSVLVD
VLHAPERLFISGSDLYQKCENGVVIAKLIQHCKSLLQHGQEALCVRVLQTLCQMASNTKY
NFINQAREVRINLLKQYFGDDAKRNTCRQTTKLESNGYAFGNDLKPIKELSLYDVQCKLN
SAGASDLVIDLIMEEPSYEVFLMTVQLSKALLYEGNYEVQMSFYNRLKEKDTSEPFFNAL
KTKLQVAQNKLRSDMMVCNDSRQRHSISNSISGRSSLINSPLPEDSAYIPNELKSIDVNS
IELAVSLSTIPDGCLLGLFDPDINLNFWDDKKTVLPQEVALIEPVLRFLQLLCENHNLVL
QNFLRYQGSRQNYNLVDETLMFLDVICGSTKGCLGVFGEIDEHNFSLITQTLVTLTEFCQ
GPCYENQNTVGNHESGLNMIISLVLNEIKPLCLTHMDLALEIKSAASKLLLAVMESRCDA
DNAERVLINMDHMASGAKQLVQAIKMAYEMSEMKEFAVPKIRKNFETNYSSKKSKSRIGR
PDIAIQDNIVISYPSTHVTLVDPQEVGHNIFILATQLARYNGTLREALDPENNKDSMTSK
ALRYYKQYTAQIEIVRSDRKMERVIFPIHAICEYLTPESKLNILLETEQDAQGSKVTEFF
SQWPELFEEMKWQKKLQDRKYFSNCTKRLILWTRISFFFAILINIIIAIFYPFSGSNRQE
LISPSNPFLYIFPTVSLLFLRMQWSEKALLGRTNEIYWAFAAIMSSFTILFITVIGVVLT
LRVVGLLQLINKGVHIVSYIGNRGLIDKTWPERLQDNGIWYHLAYLLICIQGLIVHPLFY
ALLLFDIVASEETLRNVIRSVTRNWRSVIMTGLLAVILVYLFSIIGYLYFQKDFQLEVDR
LDDNENDNIAYENFPSMQCIRPSSFIFRHYINENKCLAENLATNQPIDDKEELKVWSCQT
LRMCILTTLNWGLRNGGGIGDVLRNVAPNEESFLSRIVYDLTFFIVIIIIVLNLVFGVII
DTFGDLRAERNEKVNQLRNNCFICGLGRERFDNKIITFEEHRKNEHNLYHYLYFIVWLQI
KDETEFTGPESYVANCIKDHRSDWFPRMQAMSLAEDNQEAEQKDDINEIFDSLNRLLNTV
EEQGRQLEELKQLLYKQNALQLVTPLLLNK
Download sequence
Identical sequences A0A0H5S2G8
Bm3788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]