SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H5VUQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H5VUQ6
Domain Number 1 Region: 465-553
Classification Level Classification E-value
Superfamily PilZ domain-like 0.000000902
Family PilZ domain 0.019
Further Details:      
 
Weak hits

Sequence:  A0A0H5VUQ6
Domain Number - Region: 141-199
Classification Level Classification E-value
Superfamily PilZ domain-like 0.000145
Family PilZ domain 0.019
Further Details:      
 
Domain Number - Region: 190-279
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00667
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H5VUQ6
Sequence length 779
Comment (tr|A0A0H5VUQ6|A0A0H5VUQ6_VIBCL) Pilus assembly protein PilZ {ECO:0000313|EMBL:AKO75817.1} KW=Complete proteome OX=666 OS=Vibrio cholerae. GN=BTY66_07865 OC=Vibrionaceae; Vibrio.
Sequence
MQQTEILSLVERLIPVYRSGDLDYLLSQMTEGHPPSAKLLVKMELNRLMAPCTKSIDLRG
KVQGECREYHFDGRQHWLDDVAFNSYQKSLKKFGAYTEGVWEAVNNTRNNFRVMKQQGKL
DPKTDQPKDTSFEVEPVKLGYDLKRQENRLKISSQIEIHLKNEQLVHGLSVDLSPSGAKL
KVPAAFDYKLGEVIQVYFSDLNKTSNVVGLHKSIDYRILGVDESYDSDAIKFLRVLKLSD
TDVIEKVIEEAIQTNTQKARHDNQDKIIRARTRGYEHMYLKHTCNLPLFFSGNELKLALL
TENNRPIWQYWHDERNQQALGTLFKPERMAHLTAPGVRGSNNVLYAFKHEHQHKTLFFSM
LMPEATQEQRKLFWHIGAKRDSWKAFRLFVFELSDEERKTLAEHSRELADQSRSLTHCGV
LQEISDTEAAHDYLLVEKPNLPSSALNDFRHPRQVVGTPMGIYFDARSRRKEPRYRFSTP
VQVSIDALKVTGATVDLSKRGLSLLLDTPLDVKANDQVWVDYLELKLYDKSLPLDKAPYK
VVRIGPEGRRLQLVIEENLQTLKTIAFFNSIIEHNQDKLLIKEEILPSNALLESLHNILL
DKMVSTPFFVEKVGSNLKPKVIGVNYPLPPHLALLAKLGSENRITLQPIFKGHTNSLLAT
PMKRIEGAVPQYHEVYLSAVKYGTRIQSVESRLLSDFADTRERIRFIRQGQAMGEFYALR
VSGVPVFAPITNLLRSDLTELAEISPHHAKSLEKEMLAQVGYGELVDITEEVLIRLELT
Download sequence
Identical sequences A0A0H3Q111 A0A0H5VUQ6 A0A0K9UR62 A0A0X1KZB6 C3LQB6 Q9KPM3
gi|229607095|ref|YP_002877743.1| gi|360036217|ref|YP_004937980.1| gi|15642341|ref|NP_231974.1| NP_231974.1.72393 WP_001187860.1.100264 WP_001187860.1.100388 WP_001187860.1.100440 WP_001187860.1.10071 WP_001187860.1.100976 WP_001187860.1.101117 WP_001187860.1.10121 WP_001187860.1.101220 WP_001187860.1.101314 WP_001187860.1.101507 WP_001187860.1.101933 WP_001187860.1.102054 WP_001187860.1.1024 WP_001187860.1.10626 WP_001187860.1.10834 WP_001187860.1.10887 WP_001187860.1.11270 WP_001187860.1.11351 WP_001187860.1.11879 WP_001187860.1.11885 WP_001187860.1.11965 WP_001187860.1.12252 WP_001187860.1.12262 WP_001187860.1.12332 WP_001187860.1.12525 WP_001187860.1.12527 WP_001187860.1.12548 WP_001187860.1.12590 WP_001187860.1.12686 WP_001187860.1.13053 WP_001187860.1.13155 WP_001187860.1.13156 WP_001187860.1.13454 WP_001187860.1.13652 WP_001187860.1.13725 WP_001187860.1.14080 WP_001187860.1.14257 WP_001187860.1.14263 WP_001187860.1.14904 WP_001187860.1.14995 WP_001187860.1.15109 WP_001187860.1.15179 WP_001187860.1.15200 WP_001187860.1.15516 WP_001187860.1.15786 WP_001187860.1.15997 WP_001187860.1.16351 WP_001187860.1.16382 WP_001187860.1.17232 WP_001187860.1.17295 WP_001187860.1.17621 WP_001187860.1.18375 WP_001187860.1.18392 WP_001187860.1.18447 WP_001187860.1.18577 WP_001187860.1.18862 WP_001187860.1.18916 WP_001187860.1.19126 WP_001187860.1.19128 WP_001187860.1.19442 WP_001187860.1.19503 WP_001187860.1.19597 WP_001187860.1.20065 WP_001187860.1.20107 WP_001187860.1.20379 WP_001187860.1.20404 WP_001187860.1.20602 WP_001187860.1.20669 WP_001187860.1.20699 WP_001187860.1.20758 WP_001187860.1.21073 WP_001187860.1.21281 WP_001187860.1.21558 WP_001187860.1.21671 WP_001187860.1.21717 WP_001187860.1.21764 WP_001187860.1.21815 WP_001187860.1.21866 WP_001187860.1.22521 WP_001187860.1.22773 WP_001187860.1.229 WP_001187860.1.22953 WP_001187860.1.2304 WP_001187860.1.23333 WP_001187860.1.2341 WP_001187860.1.23416 WP_001187860.1.23424 WP_001187860.1.23538 WP_001187860.1.2354 WP_001187860.1.23808 WP_001187860.1.23955 WP_001187860.1.240 WP_001187860.1.2401 WP_001187860.1.24106 WP_001187860.1.24280 WP_001187860.1.24345 WP_001187860.1.24399 WP_001187860.1.24980 WP_001187860.1.26020 WP_001187860.1.26156 WP_001187860.1.2627 WP_001187860.1.26326 WP_001187860.1.26508 WP_001187860.1.26580 WP_001187860.1.27186 WP_001187860.1.27435 WP_001187860.1.27458 WP_001187860.1.27639 WP_001187860.1.27863 WP_001187860.1.28431 WP_001187860.1.2849 WP_001187860.1.28508 WP_001187860.1.29095 WP_001187860.1.29535 WP_001187860.1.29708 WP_001187860.1.29889 WP_001187860.1.30107 WP_001187860.1.30292 WP_001187860.1.3032 WP_001187860.1.30360 WP_001187860.1.3054 WP_001187860.1.30927 WP_001187860.1.31096 WP_001187860.1.31718 WP_001187860.1.32264 WP_001187860.1.32271 WP_001187860.1.32814 WP_001187860.1.32955 WP_001187860.1.33019 WP_001187860.1.33093 WP_001187860.1.33625 WP_001187860.1.33811 WP_001187860.1.33819 WP_001187860.1.34108 WP_001187860.1.34195 WP_001187860.1.34261 WP_001187860.1.34634 WP_001187860.1.3514 WP_001187860.1.35201 WP_001187860.1.35266 WP_001187860.1.35630 WP_001187860.1.35881 WP_001187860.1.3635 WP_001187860.1.36354 WP_001187860.1.36513 WP_001187860.1.36668 WP_001187860.1.36686 WP_001187860.1.36874 WP_001187860.1.36973 WP_001187860.1.37054 WP_001187860.1.37260 WP_001187860.1.37262 WP_001187860.1.37537 WP_001187860.1.37676 WP_001187860.1.37784 WP_001187860.1.37999 WP_001187860.1.38420 WP_001187860.1.38590 WP_001187860.1.39514 WP_001187860.1.39675 WP_001187860.1.39853 WP_001187860.1.39933 WP_001187860.1.40039 WP_001187860.1.40152 WP_001187860.1.40433 WP_001187860.1.40459 WP_001187860.1.40470 WP_001187860.1.40491 WP_001187860.1.40542 WP_001187860.1.40571 WP_001187860.1.40740 WP_001187860.1.41573 WP_001187860.1.4175 WP_001187860.1.42128 WP_001187860.1.42152 WP_001187860.1.42498 WP_001187860.1.42617 WP_001187860.1.4272 WP_001187860.1.42783 WP_001187860.1.4284 WP_001187860.1.42853 WP_001187860.1.42865 WP_001187860.1.42885 WP_001187860.1.43222 WP_001187860.1.43335 WP_001187860.1.4365 WP_001187860.1.43884 WP_001187860.1.439 WP_001187860.1.44569 WP_001187860.1.44709 WP_001187860.1.44730 WP_001187860.1.45055 WP_001187860.1.45127 WP_001187860.1.45155 WP_001187860.1.45206 WP_001187860.1.45264 WP_001187860.1.45372 WP_001187860.1.45704 WP_001187860.1.45842 WP_001187860.1.45903 WP_001187860.1.45958 WP_001187860.1.46118 WP_001187860.1.46146 WP_001187860.1.4661 WP_001187860.1.47202 WP_001187860.1.4730 WP_001187860.1.4731 WP_001187860.1.47417 WP_001187860.1.47428 WP_001187860.1.47736 WP_001187860.1.47796 WP_001187860.1.47846 WP_001187860.1.47942 WP_001187860.1.48128 WP_001187860.1.48715 WP_001187860.1.488 WP_001187860.1.48927 WP_001187860.1.49238 WP_001187860.1.49317 WP_001187860.1.50277 WP_001187860.1.50577 WP_001187860.1.50625 WP_001187860.1.50813 WP_001187860.1.50822 WP_001187860.1.50980 WP_001187860.1.51160 WP_001187860.1.51177 WP_001187860.1.51661 WP_001187860.1.5201 WP_001187860.1.52391 WP_001187860.1.5320 WP_001187860.1.53214 WP_001187860.1.5397 WP_001187860.1.54191 WP_001187860.1.5425 WP_001187860.1.54398 WP_001187860.1.5450 WP_001187860.1.54706 WP_001187860.1.54901 WP_001187860.1.55092 WP_001187860.1.55665 WP_001187860.1.55932 WP_001187860.1.56429 WP_001187860.1.56785 WP_001187860.1.56807 WP_001187860.1.57148 WP_001187860.1.57300 WP_001187860.1.57518 WP_001187860.1.57546 WP_001187860.1.57678 WP_001187860.1.57945 WP_001187860.1.58295 WP_001187860.1.58596 WP_001187860.1.58844 WP_001187860.1.58975 WP_001187860.1.59010 WP_001187860.1.59194 WP_001187860.1.59378 WP_001187860.1.59394 WP_001187860.1.5943 WP_001187860.1.59554 WP_001187860.1.59633 WP_001187860.1.59741 WP_001187860.1.59916 WP_001187860.1.60386 WP_001187860.1.60694 WP_001187860.1.60955 WP_001187860.1.61169 WP_001187860.1.61523 WP_001187860.1.61644 WP_001187860.1.61753 WP_001187860.1.61869 WP_001187860.1.61875 WP_001187860.1.61935 WP_001187860.1.62165 WP_001187860.1.62324 WP_001187860.1.62425 WP_001187860.1.63347 WP_001187860.1.63546 WP_001187860.1.63655 WP_001187860.1.6366 WP_001187860.1.63723 WP_001187860.1.63749 WP_001187860.1.63779 WP_001187860.1.63911 WP_001187860.1.64201 WP_001187860.1.64253 WP_001187860.1.64315 WP_001187860.1.64382 WP_001187860.1.64441 WP_001187860.1.6455 WP_001187860.1.65007 WP_001187860.1.65051 WP_001187860.1.65086 WP_001187860.1.66329 WP_001187860.1.66633 WP_001187860.1.66696 WP_001187860.1.67616 WP_001187860.1.68424 WP_001187860.1.68506 WP_001187860.1.68723 WP_001187860.1.68925 WP_001187860.1.69049 WP_001187860.1.69843 WP_001187860.1.69857 WP_001187860.1.70069 WP_001187860.1.70176 WP_001187860.1.70247 WP_001187860.1.7049 WP_001187860.1.70813 WP_001187860.1.70892 WP_001187860.1.71129 WP_001187860.1.72106 WP_001187860.1.72241 WP_001187860.1.72326 WP_001187860.1.72361 WP_001187860.1.72369 WP_001187860.1.7238 WP_001187860.1.72480 WP_001187860.1.72856 WP_001187860.1.73148 WP_001187860.1.73429 WP_001187860.1.73555 WP_001187860.1.73855 WP_001187860.1.73929 WP_001187860.1.74111 WP_001187860.1.74503 WP_001187860.1.74666 WP_001187860.1.74991 WP_001187860.1.75012 WP_001187860.1.75326 WP_001187860.1.75378 WP_001187860.1.755 WP_001187860.1.75778 WP_001187860.1.76425 WP_001187860.1.76486 WP_001187860.1.7654 WP_001187860.1.76645 WP_001187860.1.77029 WP_001187860.1.7717 WP_001187860.1.77355 WP_001187860.1.77397 WP_001187860.1.77445 WP_001187860.1.77703 WP_001187860.1.77794 WP_001187860.1.77830 WP_001187860.1.77914 WP_001187860.1.78157 WP_001187860.1.78531 WP_001187860.1.79044 WP_001187860.1.79943 WP_001187860.1.80024 WP_001187860.1.8023 WP_001187860.1.80339 WP_001187860.1.80500 WP_001187860.1.80618 WP_001187860.1.80628 WP_001187860.1.80702 WP_001187860.1.80744 WP_001187860.1.80808 WP_001187860.1.8117 WP_001187860.1.81871 WP_001187860.1.81917 WP_001187860.1.82119 WP_001187860.1.82193 WP_001187860.1.82248 WP_001187860.1.82262 WP_001187860.1.82413 WP_001187860.1.82583 WP_001187860.1.83040 WP_001187860.1.83073 WP_001187860.1.83082 WP_001187860.1.83109 WP_001187860.1.83703 WP_001187860.1.83761 WP_001187860.1.84385 WP_001187860.1.84519 WP_001187860.1.84610 WP_001187860.1.8480 WP_001187860.1.85007 WP_001187860.1.85388 WP_001187860.1.85498 WP_001187860.1.85822 WP_001187860.1.85878 WP_001187860.1.85961 WP_001187860.1.85972 WP_001187860.1.85998 WP_001187860.1.86057 WP_001187860.1.86192 WP_001187860.1.86269 WP_001187860.1.86874 WP_001187860.1.86879 WP_001187860.1.87335 WP_001187860.1.87355 WP_001187860.1.87573 WP_001187860.1.87602 WP_001187860.1.87804 WP_001187860.1.88057 WP_001187860.1.88230 WP_001187860.1.88283 WP_001187860.1.88350 WP_001187860.1.88556 WP_001187860.1.8867 WP_001187860.1.89144 WP_001187860.1.89441 WP_001187860.1.89447 WP_001187860.1.89822 WP_001187860.1.89889 WP_001187860.1.8997 WP_001187860.1.89995 WP_001187860.1.90133 WP_001187860.1.90227 WP_001187860.1.90437 WP_001187860.1.90675 WP_001187860.1.90774 WP_001187860.1.90889 WP_001187860.1.91247 WP_001187860.1.91262 WP_001187860.1.91274 WP_001187860.1.91539 WP_001187860.1.91747 WP_001187860.1.91794 WP_001187860.1.91841 WP_001187860.1.92038 WP_001187860.1.92063 WP_001187860.1.92069 WP_001187860.1.92157 WP_001187860.1.92401 WP_001187860.1.92516 WP_001187860.1.92559 WP_001187860.1.92696 WP_001187860.1.92703 WP_001187860.1.92952 WP_001187860.1.92993 WP_001187860.1.9302 WP_001187860.1.93399 WP_001187860.1.93836 WP_001187860.1.93945 WP_001187860.1.94255 WP_001187860.1.94426 WP_001187860.1.94441 WP_001187860.1.94481 WP_001187860.1.94887 WP_001187860.1.95516 WP_001187860.1.95549 WP_001187860.1.9561 WP_001187860.1.95662 WP_001187860.1.95733 WP_001187860.1.95976 WP_001187860.1.96001 WP_001187860.1.9607 WP_001187860.1.96089 WP_001187860.1.96187 WP_001187860.1.96311 WP_001187860.1.96471 WP_001187860.1.9660 WP_001187860.1.96687 WP_001187860.1.96693 WP_001187860.1.96704 WP_001187860.1.96980 WP_001187860.1.97100 WP_001187860.1.97144 WP_001187860.1.97516 WP_001187860.1.97552 WP_001187860.1.97650 WP_001187860.1.97799 WP_001187860.1.97832 WP_001187860.1.9787 WP_001187860.1.98021 WP_001187860.1.98116 WP_001187860.1.98172 WP_001187860.1.98246 WP_001187860.1.98280 WP_001187860.1.98624 WP_001187860.1.98642 WP_001187860.1.99128 WP_001187860.1.99204 WP_001187860.1.99417 WP_001187860.1.99452 WP_001187860.1.995 WP_001187860.1.99861 WP_001187860.1.99872 WP_001187860.1.99949 WP_001187860.1.99992 gi|227082468|ref|YP_002811019.1| 243277.VC2344 579112.VCM66_2267 593588.VCD_002004 APC26770 gi|379742136|ref|YP_005334105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]