SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H6Y2E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H6Y2E7
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 0.0000000000000248
Family Methylesterase CheB, C-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H6Y2E7
Sequence length 75
Comment (tr|A0A0H6Y2E7|A0A0H6Y2E7_VIBCL) Two-component system, chemotaxis family, response regulator CheB {ECO:0000313|EMBL:CSD02169.1} KW=Complete proteome OX=666 OS=Vibrio cholerae. GN=ERS013197_04477 OC=Vibrionaceae; Vibrio.
Sequence
MLTGMGDDGANEMAQVAQGNGIVFAQEPTTCVVPSMPEALLKRVPHIPTGTPEHLAYLMT
EVVRQSSRELHYGNH
Download sequence
Identical sequences A0A0H6Y2E7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]