SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H7BAX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H7BAX0
Domain Number 1 Region: 157-348
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-48
Family Methylesterase CheB, C-terminal domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily CheY-like 5.98e-26
Family CheY-related 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H7BAX0
Sequence length 358
Comment (tr|A0A0H7BAX0|A0A0H7BAX0_VIBCL) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=666 OS=Vibrio cholerae. GN=BTY66_08675 OC=Vibrionaceae; Vibrio.
Sequence
MKILVVDDSALMRTTISDILQNIPNAEIKTARDGMDAIDKVMKWQPDVMTLDINMPNMDG
LTCLTQIMVERPLPIVMLSSLTHEGAITTLEALYLGAVDFVAKPGGTICGRLQEVAPLIR
EKVRAAAKMRVKVHTQLSVSPAEVEHKHKSPVVENNEDHQLAIMGVSTGGPGTVETILRH
LPADFSLPIIVNQHMPESFTAAFAQRLNRHLQQPVKEINRALVLEAGTVYVCKGDRDCIV
TLRDGKLAAMPTPNDSHFSWHPSVSKLVASAIRTCGEDNLLCVMLTGMGDDGATEMAQVA
QGNGIVFAQEPTTCVVPSMPEALLKRVPHIPTGTPEHLAYLMTEVVRQSSRELHYGNH
Download sequence
Identical sequences A0A0H3PXX1 A0A0H7BAX0 A0A0K9UZ86 A0A0X1KWJ5 C3LM96 Q9KS59
gi|229608026|ref|YP_002878674.1| NP_231044.1.72393 WP_000699594.1.100264 WP_000699594.1.100388 WP_000699594.1.100440 WP_000699594.1.10071 WP_000699594.1.100976 WP_000699594.1.101117 WP_000699594.1.10121 WP_000699594.1.101220 WP_000699594.1.101314 WP_000699594.1.101507 WP_000699594.1.101933 WP_000699594.1.102054 WP_000699594.1.1024 WP_000699594.1.10626 WP_000699594.1.10834 WP_000699594.1.11270 WP_000699594.1.11351 WP_000699594.1.11879 WP_000699594.1.11885 WP_000699594.1.11965 WP_000699594.1.12252 WP_000699594.1.12262 WP_000699594.1.12332 WP_000699594.1.12525 WP_000699594.1.12527 WP_000699594.1.12548 WP_000699594.1.12590 WP_000699594.1.12686 WP_000699594.1.13053 WP_000699594.1.13155 WP_000699594.1.13156 WP_000699594.1.13454 WP_000699594.1.13652 WP_000699594.1.13725 WP_000699594.1.14080 WP_000699594.1.14257 WP_000699594.1.14263 WP_000699594.1.14904 WP_000699594.1.14995 WP_000699594.1.15109 WP_000699594.1.15179 WP_000699594.1.15200 WP_000699594.1.15516 WP_000699594.1.15786 WP_000699594.1.15997 WP_000699594.1.16351 WP_000699594.1.16382 WP_000699594.1.17232 WP_000699594.1.17295 WP_000699594.1.17621 WP_000699594.1.18375 WP_000699594.1.18392 WP_000699594.1.18447 WP_000699594.1.18577 WP_000699594.1.18862 WP_000699594.1.18916 WP_000699594.1.19126 WP_000699594.1.19128 WP_000699594.1.19442 WP_000699594.1.19503 WP_000699594.1.19597 WP_000699594.1.20065 WP_000699594.1.20107 WP_000699594.1.20379 WP_000699594.1.20404 WP_000699594.1.20602 WP_000699594.1.20669 WP_000699594.1.20699 WP_000699594.1.20758 WP_000699594.1.21073 WP_000699594.1.21281 WP_000699594.1.21558 WP_000699594.1.21671 WP_000699594.1.21717 WP_000699594.1.21764 WP_000699594.1.21815 WP_000699594.1.21866 WP_000699594.1.22521 WP_000699594.1.22773 WP_000699594.1.229 WP_000699594.1.22953 WP_000699594.1.2304 WP_000699594.1.23333 WP_000699594.1.2341 WP_000699594.1.23416 WP_000699594.1.23424 WP_000699594.1.23538 WP_000699594.1.2354 WP_000699594.1.23808 WP_000699594.1.23955 WP_000699594.1.240 WP_000699594.1.2401 WP_000699594.1.24106 WP_000699594.1.24280 WP_000699594.1.24345 WP_000699594.1.24399 WP_000699594.1.24980 WP_000699594.1.26020 WP_000699594.1.26156 WP_000699594.1.2627 WP_000699594.1.26326 WP_000699594.1.26508 WP_000699594.1.26580 WP_000699594.1.27186 WP_000699594.1.27435 WP_000699594.1.27458 WP_000699594.1.27639 WP_000699594.1.27863 WP_000699594.1.28431 WP_000699594.1.2849 WP_000699594.1.29095 WP_000699594.1.29535 WP_000699594.1.29708 WP_000699594.1.29889 WP_000699594.1.30107 WP_000699594.1.30292 WP_000699594.1.3032 WP_000699594.1.30360 WP_000699594.1.3054 WP_000699594.1.30927 WP_000699594.1.31718 WP_000699594.1.32264 WP_000699594.1.32271 WP_000699594.1.32814 WP_000699594.1.32955 WP_000699594.1.33019 WP_000699594.1.33093 WP_000699594.1.33625 WP_000699594.1.33811 WP_000699594.1.33819 WP_000699594.1.34108 WP_000699594.1.34195 WP_000699594.1.34634 WP_000699594.1.3514 WP_000699594.1.35201 WP_000699594.1.35266 WP_000699594.1.35630 WP_000699594.1.35881 WP_000699594.1.3635 WP_000699594.1.36354 WP_000699594.1.36513 WP_000699594.1.36668 WP_000699594.1.36686 WP_000699594.1.36973 WP_000699594.1.37054 WP_000699594.1.37262 WP_000699594.1.37537 WP_000699594.1.37676 WP_000699594.1.37784 WP_000699594.1.37999 WP_000699594.1.38420 WP_000699594.1.38590 WP_000699594.1.39514 WP_000699594.1.39675 WP_000699594.1.39853 WP_000699594.1.39933 WP_000699594.1.40039 WP_000699594.1.40152 WP_000699594.1.40433 WP_000699594.1.40459 WP_000699594.1.40470 WP_000699594.1.40484 WP_000699594.1.40491 WP_000699594.1.40542 WP_000699594.1.40740 WP_000699594.1.41573 WP_000699594.1.4175 WP_000699594.1.42128 WP_000699594.1.42152 WP_000699594.1.42498 WP_000699594.1.42617 WP_000699594.1.4272 WP_000699594.1.4284 WP_000699594.1.42853 WP_000699594.1.42865 WP_000699594.1.42885 WP_000699594.1.43335 WP_000699594.1.4365 WP_000699594.1.43884 WP_000699594.1.439 WP_000699594.1.44569 WP_000699594.1.44709 WP_000699594.1.44730 WP_000699594.1.45055 WP_000699594.1.45127 WP_000699594.1.45155 WP_000699594.1.45206 WP_000699594.1.45264 WP_000699594.1.45372 WP_000699594.1.45704 WP_000699594.1.45842 WP_000699594.1.45903 WP_000699594.1.45958 WP_000699594.1.46118 WP_000699594.1.46146 WP_000699594.1.4661 WP_000699594.1.47202 WP_000699594.1.4730 WP_000699594.1.4731 WP_000699594.1.47417 WP_000699594.1.47428 WP_000699594.1.47796 WP_000699594.1.47846 WP_000699594.1.47942 WP_000699594.1.48128 WP_000699594.1.48715 WP_000699594.1.488 WP_000699594.1.48927 WP_000699594.1.49238 WP_000699594.1.49317 WP_000699594.1.50277 WP_000699594.1.50577 WP_000699594.1.50625 WP_000699594.1.50813 WP_000699594.1.50822 WP_000699594.1.50980 WP_000699594.1.51160 WP_000699594.1.51177 WP_000699594.1.51661 WP_000699594.1.5201 WP_000699594.1.52391 WP_000699594.1.5320 WP_000699594.1.53214 WP_000699594.1.5397 WP_000699594.1.54191 WP_000699594.1.5425 WP_000699594.1.54398 WP_000699594.1.5450 WP_000699594.1.54706 WP_000699594.1.54901 WP_000699594.1.55092 WP_000699594.1.55665 WP_000699594.1.55929 WP_000699594.1.55932 WP_000699594.1.56429 WP_000699594.1.56785 WP_000699594.1.57148 WP_000699594.1.57300 WP_000699594.1.57546 WP_000699594.1.57678 WP_000699594.1.57945 WP_000699594.1.58295 WP_000699594.1.58596 WP_000699594.1.58844 WP_000699594.1.58975 WP_000699594.1.59010 WP_000699594.1.59194 WP_000699594.1.59378 WP_000699594.1.59394 WP_000699594.1.5943 WP_000699594.1.59554 WP_000699594.1.59633 WP_000699594.1.59741 WP_000699594.1.59916 WP_000699594.1.60386 WP_000699594.1.60633 WP_000699594.1.60694 WP_000699594.1.60955 WP_000699594.1.61169 WP_000699594.1.61523 WP_000699594.1.61644 WP_000699594.1.61753 WP_000699594.1.61869 WP_000699594.1.61875 WP_000699594.1.61935 WP_000699594.1.62165 WP_000699594.1.62324 WP_000699594.1.62425 WP_000699594.1.63347 WP_000699594.1.63546 WP_000699594.1.63655 WP_000699594.1.6366 WP_000699594.1.63723 WP_000699594.1.63749 WP_000699594.1.63779 WP_000699594.1.63911 WP_000699594.1.64201 WP_000699594.1.64253 WP_000699594.1.64315 WP_000699594.1.64382 WP_000699594.1.64441 WP_000699594.1.65007 WP_000699594.1.65051 WP_000699594.1.65086 WP_000699594.1.66329 WP_000699594.1.66633 WP_000699594.1.66696 WP_000699594.1.67616 WP_000699594.1.68424 WP_000699594.1.68506 WP_000699594.1.68723 WP_000699594.1.68925 WP_000699594.1.69049 WP_000699594.1.69843 WP_000699594.1.69857 WP_000699594.1.70069 WP_000699594.1.70176 WP_000699594.1.70247 WP_000699594.1.7049 WP_000699594.1.70813 WP_000699594.1.70892 WP_000699594.1.71129 WP_000699594.1.72106 WP_000699594.1.72241 WP_000699594.1.72326 WP_000699594.1.72361 WP_000699594.1.72369 WP_000699594.1.7238 WP_000699594.1.72480 WP_000699594.1.72856 WP_000699594.1.73148 WP_000699594.1.73429 WP_000699594.1.73555 WP_000699594.1.73855 WP_000699594.1.73929 WP_000699594.1.74111 WP_000699594.1.74503 WP_000699594.1.74666 WP_000699594.1.74991 WP_000699594.1.75012 WP_000699594.1.75326 WP_000699594.1.75378 WP_000699594.1.75778 WP_000699594.1.76425 WP_000699594.1.76486 WP_000699594.1.7654 WP_000699594.1.76645 WP_000699594.1.77029 WP_000699594.1.7717 WP_000699594.1.77355 WP_000699594.1.77397 WP_000699594.1.77445 WP_000699594.1.77703 WP_000699594.1.77794 WP_000699594.1.77830 WP_000699594.1.77914 WP_000699594.1.78157 WP_000699594.1.78531 WP_000699594.1.79044 WP_000699594.1.79776 WP_000699594.1.79943 WP_000699594.1.80024 WP_000699594.1.8023 WP_000699594.1.80339 WP_000699594.1.80618 WP_000699594.1.80628 WP_000699594.1.80702 WP_000699594.1.80744 WP_000699594.1.80808 WP_000699594.1.8117 WP_000699594.1.81871 WP_000699594.1.81917 WP_000699594.1.82119 WP_000699594.1.82193 WP_000699594.1.82248 WP_000699594.1.82262 WP_000699594.1.82413 WP_000699594.1.82583 WP_000699594.1.83040 WP_000699594.1.83073 WP_000699594.1.83082 WP_000699594.1.83109 WP_000699594.1.83703 WP_000699594.1.83761 WP_000699594.1.84385 WP_000699594.1.84519 WP_000699594.1.84610 WP_000699594.1.8480 WP_000699594.1.85007 WP_000699594.1.85498 WP_000699594.1.85822 WP_000699594.1.85878 WP_000699594.1.85961 WP_000699594.1.85972 WP_000699594.1.85998 WP_000699594.1.86057 WP_000699594.1.86192 WP_000699594.1.86269 WP_000699594.1.86879 WP_000699594.1.87274 WP_000699594.1.87286 WP_000699594.1.87335 WP_000699594.1.87355 WP_000699594.1.87573 WP_000699594.1.87602 WP_000699594.1.87804 WP_000699594.1.88057 WP_000699594.1.88230 WP_000699594.1.88283 WP_000699594.1.88350 WP_000699594.1.88556 WP_000699594.1.8867 WP_000699594.1.89144 WP_000699594.1.89441 WP_000699594.1.89447 WP_000699594.1.89822 WP_000699594.1.89889 WP_000699594.1.8997 WP_000699594.1.89995 WP_000699594.1.90133 WP_000699594.1.90227 WP_000699594.1.90437 WP_000699594.1.90675 WP_000699594.1.90774 WP_000699594.1.90889 WP_000699594.1.91247 WP_000699594.1.91262 WP_000699594.1.91274 WP_000699594.1.91539 WP_000699594.1.91747 WP_000699594.1.91794 WP_000699594.1.91841 WP_000699594.1.92038 WP_000699594.1.92063 WP_000699594.1.92069 WP_000699594.1.92157 WP_000699594.1.92401 WP_000699594.1.92516 WP_000699594.1.92559 WP_000699594.1.92696 WP_000699594.1.92703 WP_000699594.1.92952 WP_000699594.1.92993 WP_000699594.1.9302 WP_000699594.1.93060 WP_000699594.1.93399 WP_000699594.1.93836 WP_000699594.1.93945 WP_000699594.1.94255 WP_000699594.1.94426 WP_000699594.1.94441 WP_000699594.1.94481 WP_000699594.1.95516 WP_000699594.1.95549 WP_000699594.1.9561 WP_000699594.1.95662 WP_000699594.1.95733 WP_000699594.1.95976 WP_000699594.1.9607 WP_000699594.1.96089 WP_000699594.1.96187 WP_000699594.1.96311 WP_000699594.1.96471 WP_000699594.1.9660 WP_000699594.1.96687 WP_000699594.1.96704 WP_000699594.1.96980 WP_000699594.1.97100 WP_000699594.1.97144 WP_000699594.1.97516 WP_000699594.1.97552 WP_000699594.1.97650 WP_000699594.1.97799 WP_000699594.1.97832 WP_000699594.1.9787 WP_000699594.1.98021 WP_000699594.1.98116 WP_000699594.1.98172 WP_000699594.1.98246 WP_000699594.1.98280 WP_000699594.1.98624 WP_000699594.1.98642 WP_000699594.1.99128 WP_000699594.1.99204 WP_000699594.1.99417 WP_000699594.1.99452 WP_000699594.1.995 WP_000699594.1.99872 WP_000699594.1.99992 gi|15641412|ref|NP_231044.1| gi|227081572|ref|YP_002810123.1| gi|360035296|ref|YP_004937059.1| 243277.VC1401 579112.VCM66_1356 593588.VCD_002944 gi|379741197|ref|YP_005333166.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]