SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0I6HEL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0I6HEL5
Domain Number - Region: 36-174
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00732
Family Capz alpha-1 subunit 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0I6HEL5
Sequence length 408
Comment (tr|A0A0I6HEL5|A0A0I6HEL5_STREE) McrBC domain protein {ECO:0000313|EMBL:CTF86745.1} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=ERS044004_01334 OC=Streptococcus.
Sequence
MESLSQDERIFIFPNDLTHTPDLDKDQKIFETVNQKIKTGNVIGFLGYGQERLTISSRFS
DESNDHFLHYLLNKVLHINLTSLDVALSREERLYQLLVHLFPKYLQAAIRKGLYKEYHRF
SHNDSHVKGVIDVRNHLKKNLPFTGNIAYATREFTYDNPLMQLVRHTIEYIKNQKSIGQG
VLDNLSTSRENVSEIVRVTPSYKLADRAKIIRGNQSKPIRHAYFHEYRNLQELCLMILNQ
EKHGLGYQDQKIYGILFDVAWLWEEYVYTLLPKGFVHPRNKDKTDGISVFSVGKRKVYPD
FYDRERKIVLDAKYKKLELTEKGINREDLFQLISYSYILKAEKAGLVFPSKDKVIDNEIG
NLAGYGALLKKWSIQIPQKSSSYSAFCKMMENSEENFKAIIDEEVGRK
Download sequence
Identical sequences A0A0I6HEL5
WP_000445168.1.101232 WP_000445168.1.12125 WP_000445168.1.13382 WP_000445168.1.13515 WP_000445168.1.14211 WP_000445168.1.14440 WP_000445168.1.14682 WP_000445168.1.15396 WP_000445168.1.15639 WP_000445168.1.17269 WP_000445168.1.17641 WP_000445168.1.18423 WP_000445168.1.19998 WP_000445168.1.20470 WP_000445168.1.25982 WP_000445168.1.26371 WP_000445168.1.29104 WP_000445168.1.31620 WP_000445168.1.31887 WP_000445168.1.33727 WP_000445168.1.34449 WP_000445168.1.34485 WP_000445168.1.35305 WP_000445168.1.36757 WP_000445168.1.37713 WP_000445168.1.38860 WP_000445168.1.41047 WP_000445168.1.41088 WP_000445168.1.41823 WP_000445168.1.41892 WP_000445168.1.42515 WP_000445168.1.44156 WP_000445168.1.44421 WP_000445168.1.46290 WP_000445168.1.4663 WP_000445168.1.48118 WP_000445168.1.49213 WP_000445168.1.50603 WP_000445168.1.50764 WP_000445168.1.50879 WP_000445168.1.5212 WP_000445168.1.58021 WP_000445168.1.58333 WP_000445168.1.58434 WP_000445168.1.59606 WP_000445168.1.60615 WP_000445168.1.60693 WP_000445168.1.61404 WP_000445168.1.62803 WP_000445168.1.63033 WP_000445168.1.67494 WP_000445168.1.68784 WP_000445168.1.73065 WP_000445168.1.74314 WP_000445168.1.74448 WP_000445168.1.75490 WP_000445168.1.76830 WP_000445168.1.7822 WP_000445168.1.78569 WP_000445168.1.78609 WP_000445168.1.78965 WP_000445168.1.79349 WP_000445168.1.80691 WP_000445168.1.80774 WP_000445168.1.82306 WP_000445168.1.82929 WP_000445168.1.8347 WP_000445168.1.84038 WP_000445168.1.84505 WP_000445168.1.8481 WP_000445168.1.89565 WP_000445168.1.90166 WP_000445168.1.91193 WP_000445168.1.9403 WP_000445168.1.97804 WP_000445168.1.97831 WP_000445168.1.9902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]