SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0I9ZT05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0I9ZT05
Domain Number 1 Region: 333-518
Classification Level Classification E-value
Superfamily MIR domain 9.68e-60
Family MIR domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0I9ZT05
Sequence length 740
Comment (tr|A0A0I9ZT05|A0A0I9ZT05_GIBFU) Putative dolichyl-phosphate-mannose--protein mannosyltransferase {ECO:0000313|EMBL:KLO86697.1} KW=Complete proteome OX=5127 OS=fujikuroi). GN=FFC1_01861 OC=Fusarium; Fusarium fujikuroi species complex.
Sequence
MAADKAAVASGADLGDGLRQRPVAGQANLQVPTPQPEDNKKLVKKESSLLQTLDQWEVVI
APLIFTLLAIFTRLYKIGISNIVTWDEAHFGKFGSYYIKHEYYFDVHPPLGKMLVGLSGV
LAGYNGTFEFKSGEKYPEEVNYTIMRIFNAAFGIFCIPLAYYTARELKLRRPAVWLVTLM
VLCENSYTTISRFILLDSMLLCGTVATVFCWSKFHNQRHSSFEPEWFFWLFLTGLSIGCV
CSVKLVGLFVTALVGLYTVEDLWRKFGDTKMPVTTLGAHVITRVVGLIVIPFLIYLLSFA
LHFAILDRSGPGDAQMSSLFQANLKGTQVGKDSPLEIAIGSRATIKNMGYGGGLLHSHVQ
TYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYNPEGDLRFIGDNSVIRLIHAQTGRNL
HSHDIAAPVTRGHKEVSSYGNLTVGDDKDHWKVEVVRDSASRDRSKIRTLTTAFRLKHEV
LGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNVEAHWNDKLPPAEAGVYKSPFF
HDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHVGLRMCGWGDDIVKYFLLGNPL
IYWGSTASLGIAGLVIVWYILRWQRGVNDLSENEIDHIHYAALYPLAGWFLHYLPFVIMA
RVTYVHHYYPALYFAILNFGFLIDWFTRNRNKTIQTIVYGILYTVIIGLYIYFIPICWGM
TGNHKQYKYMKWFDNWRVTD
Download sequence
Identical sequences A0A0I9ZT05 A0A1L7V8B6 S0DK98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]