SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J0G1U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J0G1U9
Domain Number 1 Region: 27-135
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 8.76e-33
Family DNA polymerase III psi subunit 0.00000625
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J0G1U9
Sequence length 137
Comment (tr|A0A0J0G1U9|A0A0J0G1U9_ENTAS) DNA polymerase III subunit psi {ECO:0000256|PIRNR:PIRNR029225} KW=Complete proteome OX=61645 OS=Enterobacter asburiae. GN=AN696_0207975 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MTSRRDWQLQQLGITQWALRRPTALQGEIAISIPAHVRLVMVAEELPALNEPLIDDVLRS
LKMTADQVLQLTPERVAMLPPDSRCNSWRIGETNEIPLQGSQICTPALDELKANPKARSA
LWQQICEYEHDFFPHDV
Download sequence
Identical sequences A0A0J0G1U9 A0A156DQK1
WP_023310311.1.15360 WP_023310311.1.2065 WP_023310311.1.219 WP_023310311.1.22178 WP_023310311.1.23785 WP_023310311.1.24603 WP_023310311.1.3683 WP_023310311.1.43735 WP_023310311.1.44834 WP_023310311.1.45230 WP_023310311.1.47232 WP_023310311.1.49555 WP_023310311.1.55669 WP_023310311.1.61192 WP_023310311.1.6296 WP_023310311.1.7202 WP_023310311.1.75763 WP_023310311.1.75846 WP_023310311.1.83860 WP_023310311.1.86654 WP_023310311.1.92822 WP_023310311.1.93726 WP_023310311.1.94420 WP_023310311.1.98949 WP_023310311.1.99235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]