SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J0XC81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J0XC81
Domain Number 1 Region: 332-516
Classification Level Classification E-value
Superfamily MIR domain 3.4e-50
Family MIR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J0XC81
Sequence length 805
Comment (tr|A0A0J0XC81|A0A0J0XC81_9TREE) Putative dolichyl-phosphate-mannose-protein mannosyltransferase {ECO:0000313|EMBL:KLT38678.1} KW=Complete proteome; Reference proteome OX=879819 OS=Cutaneotrichosporon oleaginosum. GN=CC85DRAFT_289303 OC=Cutaneotrichosporon.
Sequence
MSVQPRLRRPRPGSPELPHTVERAYSDEHKRDAAMHPRKPPSDTSIRSEHLTSYGTCLAL
TVLAFIVRFWRISHPDEVVFDEVHFGGFASQYLRREYYFDVHPPLAKMLNALAGWLVGFD
GSFDFENIGDSYPEHNVPYIGMRSFVAVMGAITVPIVYATMRESGYPVAIAAFSAVLILF
DNGHVTQTRLILLDAALVLFMALSLFCYVKFHQQRYREFGRDWWFWMIATGASLALTLGC
KMVGLFTFFTVGAAVVWDLWNILDIKRGHPMSYFWRHFIYRAIGLIIVPFIIYLSFFWVH
FKILKFSGPGDTFMSPAFQETLAGNELLLNAQEVRYYDTITLKHKDTKQFLHSHPERYPL
RYPDGRISSQGQQVTCYAHNDTNNHWQIIPTREVPSHGRGRVVRHNDVVQFRHINTNTLL
LTHDVASPTMPTNQEFTTVAPDNEERREETFFQLQMIEAHDGEAIKTLASHFKVMHMKTR
VLLWTHKQALPEWAFEQQEVNGNKNANDRTALWYAGDIIEDGQGQDFRNRTAHVEDKPVR
HINFFKKWWELQILMLQHNAGLSSSHPYASTPIEWPFCLNGVSFWTENSKQQQIYMVGNL
LDWWICSITVSVFVGIIAADTIARRRGVEPIEEDVRNRLYRNTGFFLGAWAFHYFPFYTM
ARQRFLHHYLPAHLASALVAGSILNFILVEEVNYPMSVAGPRTRLRPATRAYVSRKGLVV
LGVLSAAVVGCFLYEAPFTYGLPLSSTQVSARKLLSTWTLHFEAKVTHDVDAVADAPPVV
AEDVAEDDFADSAVNDSPDEQIELS
Download sequence
Identical sequences A0A0J0XC81
XP_018275169.1.77916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]