SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J1CRY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1CRY2
Domain Number 1 Region: 746-953
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.83e-32
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.016
Further Details:      
 
Domain Number 2 Region: 34-215
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1e-20
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.064
Further Details:      
 
Domain Number 3 Region: 461-647
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.96e-16
Family Pyruvate oxidase and decarboxylase PP module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J1CRY2
Sequence length 1201
Comment (tr|A0A0J1CRY2|A0A0J1CRY2_9BURK) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KLU23429.1} KW=Complete proteome; Reference proteome OX=908627 OS=Caballeronia mineralivorans PML1(12). GN=EOS_25480 OC=Burkholderiaceae; Caballeronia.
Sequence
MNAPLDAEQQASLEAALNSVTLDDKYTLERGRAYMSGIQALVRLPMLQQQRDHAAGLNTA
GFISGYRGSPLGALDQHLWKAKKHLAAHQVVFQPGVNEDLAATAVWGSQQVNLYPSAKYD
GVFSMWYGKGPGVDRTGDVFKHGNSAGSSPHGGVLVLAGDDHAAKSSTLAHQSEHIFKAC
GLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVAMKCVTDVVESSASVDIDPHRTQIVLPTD
FAMPDGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLDRIEIESPHARFGIMTAGKA
YLDVRQALSDLGLDDETCARIGIRLYKVGCVWPLEAQGAHAFAHGLQEILVVEEKRQILE
YAIKEELYNWPDAQRPRVFGKFDEKDGAGGEWSVPMGNWLLPAHYELSPAIIAKAIATRL
DKFDLPADVRARIATRIAVIEAKEKALARPRVEAERKPWFCSGCPHNTSTNVPEGSRALA
GIGCHYMTVWMDRSTSTFSQMGGEGVAWIGQAPFTHDKHVFANLGDGTYFHSGLLAIRAA
IASKTNITYKILYNDAVAMTGGQPVDGVLTVPQITHQLAAEGATKIVIVTDEPEKYQANV
GLAPGIDVFHREKLDEVQRELREIAGTTILIYDQTCATEKRRRRKRGAYPDPAKRVVINE
AVCEGCGDCSVKSNCLSVEPLDTEYGTKRQINQSTCNKDYSCVNGFCPSFVTVEGGQLKK
PKISSISGDAMPPVPMPELPLIDRPYGVLVTGVGGTGVVTIGALLGMASHLEQKGVTVLD
VTGLAQKGGAVMSHVQIATHPGDIHATRIAMGEADLVIGCDPIVTASDECGSRMQPGHTR
VVVNSAETPTAEFIKNPNWRFPGASAEADIRAAAGEHVALVDANRFAVALLGDAIYTNPF
VLGFAWQRGWVPLRHESLVRAIELNAVQVEKNLAAFEWGRHAAHDLEGVERLVRAQGRGG
VSSGSSEQGGSKIIALHTPKALDALIEKRIAYLSGYQNEAYAARYARLVAEVRKAEASIG
LGDGQYALTEAVAKNLHKLMAYKDEYEVARLYVDPAFVERLKGSFEGDWKIKFHLAPPMF
SKKDAHGHLIKKQYGTWVLSAMKVLAKMKFLRGTSFDVFGKTEERKMERALIAEYEALVT
ELTGGLTAEKLPLAIELASLPDSMRGYGHVKDNNVNAARIKWNALLAQWRSSPGGETRQV
A
Download sequence
Identical sequences A0A0J1CRY2
WP_047894957.1.28875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]