SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J1EE01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1EE01
Domain Number 1 Region: 239-501
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.62e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.057
Further Details:      
 
Domain Number 2 Region: 512-616
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.77e-17
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.049
Further Details:      
 
Domain Number 3 Region: 19-256
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.42e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J1EE01
Sequence length 627
Comment (tr|A0A0J1EE01|A0A0J1EE01_RHOIS) 2-oxoglutarate oxidoreductase, alpha subunit {ECO:0000313|EMBL:KLU03759.1} KW=Complete proteome; Reference proteome OX=595434 OS=Rhodopirellula islandica. GN=RISK_004166 OC=Planctomycetaceae; Rhodopirellula.
Sequence
MTTSTPTTNKKIESVSGITVRLCGDSGDGMQLLGTQLTNTSALAGNDVATFPDFPAEIRA
PRGTRAGVSGFQVQFASEEIFTPGDTLDALVVMNPAAMVTNIADLRKGGILIANEDGFNE
KEYKLAKVESNPLDADVIDQSYRVVKVAMTKLTRAAVAEHGLSTKIADRCKNFFAMGLVY
WLFGRSLDPTLRFIEAKFGKKPDIAAANVAALRAGWAYGETTEEFGESYQVEAAELAPGT
YRNIMGNQALAWGLIAASKISNKEMFYGTYPITPASDILHELTKFKNFGVRTFQAEDEIA
AIGATIGAAFGGTMAVTASSGPGIALKGEAMGLGVMLELPMIVINVQRGGPSTGLPTKTE
QSDLLQVMFGRNGEAPMPVLAPRSPGDCFAMAVEAWRIATECMVPVMLLSDGYIANGSEP
WKIPEMDELPTIVCTHPEKHTGEGPFLPYARNENLARPWAIPGTPELMHRVGGLEKEDGT
GNVSYDPANHQHMCDTRAAKVAKIAERIPEQDVYGETSGDVLVVSWGGTYGACHTAVTRC
REAGHSVSHAHIRYINPLPRNIGTLLKSFKTVVVPELNSGQLRMLLRAEFLVDCIGINKI
QGKPFAVSELVEAIGKHTSTHSQSKAG
Download sequence
Identical sequences A0A0J1EE01
WP_047815469.1.9718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]