SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1GA25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1GA25
Domain Number 1 Region: 47-118
Classification Level Classification E-value
Superfamily CPE0013-like 1.12e-25
Family CPE0013-like 0.0025
Further Details:      
 
Domain Number 2 Region: 2-69
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.0000345
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J1GA25
Sequence length 119
Comment (tr|A0A0J1GA25|A0A0J1GA25_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KLU72230.1} KW=Complete proteome; Reference proteome OX=1504536 OS=Robinsoniella sp. RHS. GN=RHS_1857 OC=Robinsoniella.
Sequence
MEKRELTCIGCPLGCALTVTLEGNQVQQVEGNSCRRGEAYGRKECTHPTRIVTSTVAVKG
GSIARVSVKTKTDISKDKIFSCMKALKGIEVQAPVHIGDVILSNVAGTQTDIVATKNVF
Download sequence
Identical sequences A0A0J1GA25
WP_027296916.1.2070 WP_027296916.1.6658 WP_027296916.1.88847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]