SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1ID47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1ID47
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily HisI-like 1.05e-45
Family HisI-like 0.00013
Further Details:      
 
Domain Number 2 Region: 119-207
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 9.35e-26
Family HisE-like (PRA-PH) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J1ID47
Sequence length 213
Comment (tr|A0A0J1ID47|A0A0J1ID47_BACCI) Phosphoribosyl-ATP pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01019} KW=Complete proteome; Reference proteome OX=1397 OS=Bacillus circulans. GN=ABW02_18725 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MILDELKFDEKGLIPAVVQDVVTKEVLTLAYMNKESLEKSMSTGETWFYSRSRQELWHKG
GTSGNTQSIVEIKYDCDQDALVVLIQPNGPACHNGTTSCFVDSMYQNKERDVTSADYQIL
ANLEKVIEERDIKRPEGTYTTYLFEKGVDKILKKVGEEAAEVIIAAKNRDSEELKWEASD
LLYHLFVLLREQKLPFSEILQVLEARHEEKTGK
Download sequence
Identical sequences A0A0J1ID47
WP_047943773.1.65649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]